BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0432 (434 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122240-1|AAM52752.1| 124|Drosophila melanogaster SD02058p pro... 27 8.3 AE014296-3256|AAF49087.1| 720|Drosophila melanogaster CG17732-P... 27 8.3 AE014296-3146|AAO41235.1| 124|Drosophila melanogaster CG33062-P... 27 8.3 >AY122240-1|AAM52752.1| 124|Drosophila melanogaster SD02058p protein. Length = 124 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 189 DVVKRRPVNCNTTHYRANWV 130 D +K RP NC T H A WV Sbjct: 2 DQLKLRPCNCLTAHPLAEWV 21 >AE014296-3256|AAF49087.1| 720|Drosophila melanogaster CG17732-PA protein. Length = 720 Score = 27.5 bits (58), Expect = 8.3 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = -2 Query: 346 QNINAYNLPFAIQAAQLLGRAIGAGL-FAITPLAKGGCAARRLSWVTPGFSQSRRCKTTA 170 Q I AY+ QA + A+ F + P ++R + V+P + RRC+T Sbjct: 600 QRIQAYHEQQNYQAPESHTTAVELQQRFLLPPPPYCQSSSRTCTQVSPSARKVRRCRTRI 659 Query: 169 SEL*YDSL*GELGTGPPLVPARSTKP 92 SEL D ++ T PL PA P Sbjct: 660 SELGTDPYPCQIRT--PLPPASLILP 683 >AE014296-3146|AAO41235.1| 124|Drosophila melanogaster CG33062-PA protein. Length = 124 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 189 DVVKRRPVNCNTTHYRANWV 130 D +K RP NC T H A WV Sbjct: 2 DQLKLRPCNCLTAHPLAEWV 21 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,641,199 Number of Sequences: 53049 Number of extensions: 445092 Number of successful extensions: 1209 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1376136036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -