BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0432 (434 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23486-5|AAL38958.2| 326|Caenorhabditis elegans Serpentine rece... 29 1.5 >U23486-5|AAL38958.2| 326|Caenorhabditis elegans Serpentine receptor, class x protein114 protein. Length = 326 Score = 29.1 bits (62), Expect = 1.5 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 64 GFLRPC*IRTVSYSLRVRGGARYPIRPIVSRITIHWPSFYNVVTGKTL 207 GFL C +++++ ++ G +P+ P+ PSFYNV+ G+ + Sbjct: 43 GFLVVCMVKSMANNIICMGFIAWPV-PVTYLNFYFLPSFYNVLAGQII 89 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,304,960 Number of Sequences: 27780 Number of extensions: 213537 Number of successful extensions: 548 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -