BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0422 (778 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces... 75 1e-14 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 27 4.0 SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/... 25 9.2 >SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces pombe|chr 1|||Manual Length = 195 Score = 74.9 bits (176), Expect = 1e-14 Identities = 38/81 (46%), Positives = 56/81 (69%), Gaps = 2/81 (2%) Frame = +1 Query: 16 KIIKASGAEADSFETSISQALVELETNS-DLKAQLRELYITKAKEIELHN-KKSIIIYVP 189 KI+K S ++ + ++Q L +LE++S D+ +LR L IT A+E+E+ KK+I+++VP Sbjct: 6 KIVKRSSSQPTETDLLVAQCLYDLESSSKDMAKELRPLQITSAREVEVGGGKKAIVVFVP 65 Query: 190 MPKLKAFQKIQIRLVRELEKK 252 P LKAF K Q RL RELEKK Sbjct: 66 QPLLKAFHKCQARLTRELEKK 86 Score = 61.3 bits (142), Expect = 2e-10 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 386 K+ + +HV+F+ R+ILPKP K+RV QKRPRSRTLT+V++AILE Sbjct: 85 KKFADRHVIFIAQRRILPKPGRKSRVT--QKRPRSRTLTAVHNAILE 129 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.6 bits (56), Expect = 4.0 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +1 Query: 280 ETVRSCLSPATKPVLLTNKRGHAQ 351 E+ + ++ +TKPV +T+K GH++ Sbjct: 1069 ESTKPAVNNSTKPVAVTSKNGHSR 1092 >SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 671 GRKSGKNPLIKSKRIDRDKGLSVCSSFGTR 760 G++ NPL K DRD + + SS G+R Sbjct: 46 GQQQPLNPLAKPIEQDRDAIIRILSSIGSR 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,085,040 Number of Sequences: 5004 Number of extensions: 61079 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -