BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0422 (778 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 113 1e-25 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 104 7e-23 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 104 7e-23 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 104 7e-23 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 71 1e-12 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 69 6e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 67 1e-11 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 66 3e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 65 7e-11 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 64 1e-10 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 64 1e-10 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 64 1e-10 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 64 2e-10 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53831| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 63 2e-10 SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18115| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 63 3e-10 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 63 3e-10 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 63 3e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 63 3e-10 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 63 3e-10 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 63 3e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 63 3e-10 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 63 3e-10 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 63 3e-10 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 63 3e-10 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 63 3e-10 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 63 3e-10 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 63 3e-10 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 63 3e-10 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 62 4e-10 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 62 4e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 62 4e-10 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 62 4e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 62 4e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 62 4e-10 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 62 4e-10 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 62 4e-10 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 62 4e-10 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 62 4e-10 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 62 4e-10 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 62 4e-10 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 62 4e-10 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 62 4e-10 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 62 4e-10 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 62 4e-10 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 62 4e-10 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 62 4e-10 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 62 4e-10 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 62 4e-10 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29218| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 62 4e-10 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 62 4e-10 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 62 4e-10 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 62 4e-10 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 62 4e-10 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 62 4e-10 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 62 4e-10 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 62 4e-10 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 62 4e-10 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 62 4e-10 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 62 4e-10 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 62 4e-10 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 62 4e-10 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 62 4e-10 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 62 4e-10 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 62 4e-10 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 62 4e-10 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 62 4e-10 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 62 4e-10 SB_55058| Best HMM Match : HLH (HMM E-Value=1.4e-05) 62 4e-10 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 62 4e-10 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 62 4e-10 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 62 4e-10 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 62 4e-10 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 62 4e-10 SB_48721| Best HMM Match : TorD (HMM E-Value=5.3) 62 4e-10 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 62 4e-10 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45332| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 62 4e-10 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 62 4e-10 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 62 4e-10 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 62 4e-10 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 62 4e-10 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25859| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25110| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 62 4e-10 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 62 4e-10 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 62 4e-10 SB_17822| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 62 4e-10 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 62 4e-10 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 62 4e-10 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 62 4e-10 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 62 4e-10 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 62 4e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 62 5e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 62 5e-10 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 62 5e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 62 5e-10 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 62 5e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 62 5e-10 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 62 5e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 62 5e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 62 5e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 62 5e-10 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 62 5e-10 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 62 5e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 62 5e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 62 5e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 62 5e-10 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 62 5e-10 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 62 5e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 62 5e-10 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 62 5e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 62 5e-10 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 62 5e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 113 bits (273), Expect = 1e-25 Identities = 54/81 (66%), Positives = 68/81 (83%) Frame = +1 Query: 10 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 189 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 190 MPKLKAFQKIQIRLVRELEKK 252 +P+++AFQKIQ RLVRELEKK Sbjct: 68 VPQIRAFQKIQTRLVRELEKK 88 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 350 K+ SGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 87 KKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 104 bits (250), Expect = 7e-23 Identities = 50/63 (79%), Positives = 50/63 (79%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 410 HSPFRLRNCWEGRSVRA SLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 645 Query: 409 ANW 401 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 104 bits (250), Expect = 7e-23 Identities = 50/63 (79%), Positives = 50/63 (79%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 410 HSPFRLRNCWEGRSVRA SLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 409 ANW 401 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 104 bits (250), Expect = 7e-23 Identities = 50/63 (79%), Positives = 50/63 (79%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 410 HSPFRLRNCWEGRSVRA SLLRQLAKG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 409 ANW 401 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 96.3 bits (229), Expect = 2e-20 Identities = 45/59 (76%), Positives = 46/59 (77%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 401 +LRNCWEGRSVRA SLLRQLAKG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 83.0 bits (196), Expect = 2e-16 Identities = 41/52 (78%), Positives = 41/52 (78%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 435 PFAIQAA LLGRAIGAGLF ITPA ERG ARRLSWV P FSQS RC AS Sbjct: 6 PFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.4 bits (187), Expect = 3e-15 Identities = 39/55 (70%), Positives = 44/55 (80%), Gaps = 3/55 (5%) Frame = -1 Query: 556 GRSVRA--FSLLRQLAKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 401 GR++ A F++ KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 578 QAAQLLGRAIGAGLFAITPAGERG 507 QAAQLLGRAIGAGLFAITPAGE+G Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKG 65 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 75.8 bits (178), Expect = 4e-14 Identities = 39/52 (75%), Positives = 39/52 (75%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPV 434 HSPFRLRNCWEGRSVRA SLLRQLAKG GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPV 67 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 75.8 bits (178), Expect = 4e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 404 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIP Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 531 SEKARTDRPSQQLRSLNGEW 590 +E+ARTDRPSQQLRSLNGEW Sbjct: 76 AEEARTDRPSQQLRSLNGEW 95 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/53 (71%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -3 Query: 590 PFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 435 PFAIQAAQLL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 11 PFAIQAAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 73.3 bits (172), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 410 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +3 Query: 534 EKARTDRPSQQLRSLNGEW 590 E+ARTDRPSQQLRSLNGEW Sbjct: 119 EEARTDRPSQQLRSLNGEW 137 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 71.3 bits (167), Expect = 8e-13 Identities = 37/53 (69%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 590 PFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 435 PFAIQAAQL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 11 PFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 71.3 bits (167), Expect = 8e-13 Identities = 37/53 (69%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 590 PFAIQAAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 435 PFAIQAAQL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 11 PFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 70.5 bits (165), Expect = 1e-12 Identities = 37/63 (58%), Positives = 37/63 (58%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 410 HSPFRLRNCWEG R GFPSHDVVKRRPVNCNTTHYR Sbjct: 43 HSPFRLRNCWEG-------------------------RSGFPSHDVVKRRPVNCNTTHYR 77 Query: 409 ANW 401 ANW Sbjct: 78 ANW 80 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 528 NSEKARTDRPSQQLRSLNGEW 590 NSE+ARTDRPSQQLRSLNGEW Sbjct: 39 NSEEARTDRPSQQLRSLNGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 508 PLSPAGVIAKRPAPIALP 561 PLSPAGVIAKRPAPIALP Sbjct: 32 PLSPAGVIAKRPAPIALP 49 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 68.5 bits (160), Expect = 6e-12 Identities = 37/60 (61%), Positives = 40/60 (66%), Gaps = 5/60 (8%) Frame = +3 Query: 426 LQFTGRRFTTS*LGKP----WRY-PT*SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 L F GR +S P +RY P S C PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 248 LSFNGRVIVSSDSATPTLVNFRYCPFVSGCPHPPFASWRNSEEARTDRPSQQLRSLNGEW 307 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGF 468 PFAIQAAQLLGRAIGAGLFAITPAGERG + + VTP F Sbjct: 1837 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 469 FPSHDVVKRRPVNCNTTHYRANW 401 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 471 PWRYPT*SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 P R+ + SP + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 48 PPRWSSNSPYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = +3 Query: 435 TGRRFTTS*LGKPWRYPT*SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEWQ 593 TGRRFT P + PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 92 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTA 438 PFAIQAAQLLGRAIGAGLFAITPAGERG + + TP ++R+ T+ Sbjct: 1123 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 4e-11 Identities = 31/33 (93%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPF 514 SRITIHWPSFYNVVTGKTLALPNLIALQ H PF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPF 34 Score = 60.5 bits (140), Expect = 1e-09 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSE+ARTDRPSQ+LRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 65.3 bits (152), Expect = 5e-11 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 495 PCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 P S PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 37 PASHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 65.3 bits (152), Expect = 5e-11 Identities = 32/48 (66%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +2 Query: 449 YNVVTGKTLALPNLIALQHIP-FRQLA**RKGPHRSPFPTVAQPEWRM 589 Y+VVTGKTLA+P+L ALQHIP F + PHRSPFP AQPEWRM Sbjct: 13 YDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFPRDAQPEWRM 60 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 64.9 bits (151), Expect = 7e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 468 KPWRYPT*SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 +P P+ S + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 13 RPNPVPSPSDAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 53 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.9 bits (151), Expect = 7e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 511 SRITIHWPSFYNVVTGKTLALPNL L+HIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIP 32 Score = 48.0 bits (109), Expect = 8e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 513 FASWRNSEKARTDRPSQQLRSLNGEW 590 +AS SE+ARTDRPSQQLRSLNGEW Sbjct: 34 YASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 64.5 bits (150), Expect = 9e-11 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -3 Query: 575 AAQLL-GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 AAQL GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 64.1 bits (149), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 585 RHSGCATVGKGDRCGPFRYYASWRKG 508 RHSGCATVGKGDRCGP RYYASWRKG Sbjct: 241 RHSGCATVGKGDRCGPLRYYASWRKG 266 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/54 (61%), Positives = 37/54 (68%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 PFAIQAAQLLGRAIGAGLFAITPAGERG + + V F + K T E+ Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVITHFIECLCEKYTTGEM 64 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 64.1 bits (149), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 585 RHSGCATVGKGDRCGPFRYYASWRKG 508 RHSGCATVGKGDRCGP RYYASWRKG Sbjct: 87 RHSGCATVGKGDRCGPLRYYASWRKG 112 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 435 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERG--CAARRLSW 483 PFAIQAAQLLGRAIGAGLFAITPAGERG C A +L W Sbjct: 388 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVW 425 >SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSEKARTDRPSQQLRSLNGEW Sbjct: 4 PFASWRNSEKARTDRPSQQLRSLNGEW 30 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQNCKR 605 PFASWRNSE+ARTDRPSQQLRSLNGEW+ +R Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRR 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 63.7 bits (148), Expect = 2e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTP 474 PFAIQAAQLLGRAIGAGLFAITPAGERG + + V P Sbjct: 32 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 Query: 564 VGKGDRCGPFRYYASWRKGMCCKAIKLGNARVFPVTTL 451 +G+ G F + +GMCCKAIKL P TL Sbjct: 41 LGRAIGAGLFAITPAGERGMCCKAIKLVEPTEPPFKTL 78 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSEKARTDRPSQQLRSLNGEW Sbjct: 148 PFASWRNSEKARTDRPSQQLRSLNGEW 174 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHP 147 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSEKARTDRPSQQLRSLNGEW Sbjct: 83 PFASWRNSEKARTDRPSQQLRSLNGEW 109 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 495 PCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 P + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 45 PSAHPPFASWRNSEEARTDRPSQQLRSLNGEW 76 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSEKARTDRPSQQLRSLNGEW Sbjct: 33 PFASWRNSEKARTDRPSQQLRSLNGEW 59 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPF 514 SRITIHWPSFYNV+ KT + L L H PF Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPF 34 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 63.7 bits (148), Expect = 2e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVTPGF 468 PFAIQAAQLLGRAIGAGLFAITPAGERG + + + PGF Sbjct: 112 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIK-LEPGF 151 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVT 477 PFAIQAAQLLGRAIGAGLFAITPAGERG + + VT Sbjct: 77 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 114 >SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 495 PCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 P + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 45 PYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 76 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +2 Query: 419 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPF 514 SRITIHWPSFYNVVTGKTLALPNLIAL H PF Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPF 34 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 63.3 bits (147), Expect = 2e-10 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERG--CAARRLSWVTPGFSQS 459 PFAIQAAQLLGRAIGAGLFAITPAGERG C A +L+ V S S Sbjct: 111 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLALVVSVLSSS 156 >SB_53831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 492 SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 +P + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 22 APKAHPPFASWRNSEEARTDRPSQQLRSLNGEW 54 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 590 PFAIQAAQLLGRAIGAGLFAITPAGERGCAARRLSWVT 477 PFAIQAAQLLGRAIGAGLFAITPAGERG + + VT Sbjct: 4 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 41 >SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 477 RYPT*SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 R P S + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 22 RAPLGSIVAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_18115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 492 SPCSTSPFASWRNSEKARTDRPSQQLRSLNGEW 590 +P + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 42 NPPAHPPFASWRNSEEARTDRPSQQLRSLNGEW 74 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKG 509 +LRNCWEGRSVRA SLLRQLAKG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKG 397 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 231 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 48.0 bits (109), Expect = 8e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKG 509 +LRNCWEGRSVRA SLLRQLAKG Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 364 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 358 LRNCWEGRSVRASSLLRQLAKG 379 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 56 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNC EGRSVRA SLLRQLAKG Sbjct: 45 HSPFRLRNCGEGRSVRASSLLRQLAKG 71 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKG 53 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.9 bits (146), Expect = 3e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 487 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 401 +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 573 CATVGKGDRCGPFRYYASWRKGMCCKAIKLGNARVFP 463 CATVGKGDRCG F + +GMCCKAIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKG 509 RLRNCWEGRSVRA SLLRQLAKG Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 258 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 48.0 bits (109), Expect = 8e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKG 509 +LRNCWEGRSVRA SLLRQLAKG Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 H RLRNCWEGRSVRA SLLRQLAKG Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKG 287 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKG 471 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 125 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 119 LRNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 200 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 48.4 bits (110), Expect = 6e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 6/38 (15%) Frame = -1 Query: 604 RLQFCHSPF------RLRNCWEGRSVRAFSLLRQLAKG 509 RL+ PF +LRNCWEGRSVRA SLLRQLAKG Sbjct: 178 RLELSFEPFPSANSNKLRNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 228 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 598 QFCHSPFRLRNCWEGRSVRAFSLLRQLAKG 509 ++C S +LRNCWEGRSVRA SLLRQLAKG Sbjct: 215 KYCISA-KLRNCWEGRSVRASSLLRQLAKG 243 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 574 LRNCWEGRSVRAFSLLRQLAKG 509 LRNCWEGRSVRA SLLRQLAKG Sbjct: 83 LRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 397 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 577 RLRNCWEGRSVRAFSLLRQLAKG 509 RLRNCWEGRSVRA SLLRQLAKG Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKG 412 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 62.9 bits (146), Expect = 3e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 560 GRAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTASEL 429 GR++ A + + GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKG 205 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 40 PFASWRNSEEARTDRPSQQLRSLNGEWR 67 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 448 LQRRDWENPGVTQLNRLAAHP 510 LQRRDWENPGVTQLNRLAAHP Sbjct: 19 LQRRDWENPGVTQLNRLAAHP 39 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWR 114 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWR 77 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWR 101 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWR 80 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEWR 81 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWR 70 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 858 PFASWRNSEEARTDRPSQQLRSLNGEWR 885 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEWR 166 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWR 91 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 36 PFASWRNSEEARTDRPSQQLRSLNGEWR 63 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWR 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRN+EKARTDRPSQQLRSLNGEW Sbjct: 74 PFASWRNNEKARTDRPSQQLRSLNGEW 100 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWR 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWR 89 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 31 PFASWRNSEEARTDRPSQQLRSLNGEWR 58 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/28 (67%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 434 HWPSFYNVVTGKTLALPNLIAL-QHIPF 514 HWPSFYNVVTGKTL + L L H PF Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 157 PFASWRNSEEARTDRPSQQLRSLNGEWR 184 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHP 156 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWR 74 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 178 PFASWRNSEEARTDRPSQQLRSLNGEWR 205 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWR 109 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWR 73 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEWR 99 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 L VVLQRRDWENPGVTQLNRLAAHP Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHP 71 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWR 112 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 501 STSPFASWRNSEKARTDRPSQQLRSLNGEW 590 S PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 19 SHPPFASWRNSEEARTDRPSQQLRSLNGEW 48 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 238 PFASWRNSEEARTDRPSQQLRSLNGEWR 265 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWR 85 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +1 Query: 337 RGHAQGH*PLCTMLSSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 510 +G++ P+ + S G P+ LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 2 QGYSPTSFPVTPRIQSYGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWR 100 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWR 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEWR 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWR 74 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWR 109 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWR 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWR 80 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWR 198 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWR 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWR 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWR 152 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 1215 PFASWRNSEEARTDRPSQQLRSLNGEWR 1242 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 589 HSPFRLRNCWEGRSVRAFSLLRQLAKG 509 HSPFRLRNCWEGRSVRA SLLRQLAKG Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKG 430 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHP 1214 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWR 84 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 150 PFASWRNSEEARTDRPSQQLRSLNGEWR 177 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 102 PFASWRNSEEARTDRPSQQLRSLNGEWR 129 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHP 101 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWR 83 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWR 86 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEWR 88 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEWR 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 86 PFASWRNSEEARTDRPSQQLRSLNGEWR 113 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWR 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWR 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWR 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWR 136 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWR 73 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEWR 117 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 49 PFASWRNSEEARTDRPSQQLRSLNGEWR 76 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 133 PFASWRNSEEARTDRPSQQLRSLNGEWR 160 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 49 PFASWRNSEEARTDRPSQQLRSLNGEWR 76 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEWR 95 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 101 PFASWRNSEEARTDRPSQQLRSLNGEWR 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEWR 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 4/43 (9%) Frame = +3 Query: 474 WRYPT*SPCST----SPFASWRNSEKARTDRPSQQLRSLNGEW 590 W+ P +P + PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 75 WKNPGVTPLNRLEAHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAV LQR DW+NPGVT LNRL AHP Sbjct: 66 LAVGLQRLDWKNPGVTPLNRLEAHP 90 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 116 PFASWRNSEEARTDRPSQQLRSLNGEWR 143 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWR 93 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 1088 PFASWRNSEEARTDRPSQQLRSLNGEWR 1115 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWR 69 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 501 STSPFASWRNSEKARTDRPSQQLRSLNGEW 590 S PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 40 SHPPFASWRNSEEARTDRPSQQLRSLNGEW 69 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWR 83 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 159 PFASWRNSEEARTDRPSQQLRSLNGEWR 186 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 207 PFASWRNSEEARTDRPSQQLRSLNGEWR 234 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 195 PFASWRNSEEARTDRPSQQLRSLNGEWR 222 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHP 194 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWR 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEWR 87 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 448 LQRRDWENPGVTQLNRLAAHP 510 LQRRDWENPGVTQLNRLAAHP Sbjct: 39 LQRRDWENPGVTQLNRLAAHP 59 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWR 71 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWR 198 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWR 110 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 141 PFASWRNSEEARTDRPSQQLRSLNGEWR 168 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 48 PFASWRNSEEARTDRPSQQLRSLNGEWR 75 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 677 PFASWRNSEEARTDRPSQQLRSLNGEWR 704 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWR 91 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 186 PFASWRNSEEARTDRPSQQLRSLNGEWR 213 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEWR 99 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWR 84 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWR 74 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWR 110 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEWR 122 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWR 69 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWR 112 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGE 587 PFASWRNSE+ARTDRPSQQLRSLNGE Sbjct: 20 PFASWRNSEEARTDRPSQQLRSLNGE 45 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 96 PFASWRNSEEARTDRPSQQLRSLNGEWR 123 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 104 PFASWRNSEEARTDRPSQQLRSLNGEWR 131 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 210 PFASWRNSEEARTDRPSQQLRSLNGEWR 237 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 469 PFASWRNSEEARTDRPSQQLRSLNGEWR 496 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWR 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 291 PFASWRNSEEARTDRPSQQLRSLNGEWR 318 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWR 86 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_29218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 501 STSPFASWRNSEKARTDRPSQQLRSLNGEW 590 S PFASWRNSE+ARTDRPSQQLRSLNGEW Sbjct: 12 SHPPFASWRNSEEARTDRPSQQLRSLNGEW 41 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 86 PFASWRNSEEARTDRPSQQLRSLNGEWR 113 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEWR 122 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 129 PFASWRNSEEARTDRPSQQLRSLNGEWR 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEWR 115 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWR 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWR 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWR 69 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWR 77 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 448 LQRRDWENPGVTQLNRLAAHP 510 LQRRDWENPGVTQLNRLAAHP Sbjct: 29 LQRRDWENPGVTQLNRLAAHP 49 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 99 PFASWRNSEEARTDRPSQQLRSLNGEWR 126 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEWR 97 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 448 LQRRDWENPGVTQLNRLAAHP 510 LQRRDWENPGVTQLNRLAAHP Sbjct: 49 LQRRDWENPGVTQLNRLAAHP 69 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEWR 135 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 201 PFASWRNSEEARTDRPSQQLRSLNGEWR 228 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWR 83 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEWR 135 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWR 101 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWR 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 167 PFASWRNSEEARTDRPSQQLRSLNGEWR 194 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHP 166 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 93 PFASWRNSEEARTDRPSQQLRSLNGEWR 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWR 109 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWR 121 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWR 68 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEW 590 PFASWRN+EKARTDRPSQQLRSLNGEW Sbjct: 72 PFASWRNNEKARTDRPSQQLRSLNGEW 98 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEWR 90 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 69 PFASWRNSEEARTDRPSQQLRSLNGEWR 96 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWR 114 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 106 PFASWRNSEEARTDRPSQQLRSLNGEWR 133 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 216 PFASWRNSEEARTDRPSQQLRSLNGEWR 243 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHP 215 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 112 PFASWRNSEEARTDRPSQQLRSLNGEWR 139 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 129 PFASWRNSEEARTDRPSQQLRSLNGEWR 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEWR 90 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEWR 102 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWR 101 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEWR 93 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWR 74 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 151 PFASWRNSEEARTDRPSQQLRSLNGEWR 178 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEWR 95 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEWR 121 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWR 107 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWR 70 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEWR 106 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWR 140 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWR 107 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEWR 110 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWR 72 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 119 PFASWRNSEEARTDRPSQQLRSLNGEWR 146 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEWR 117 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 192 PFASWRNSEEARTDRPSQQLRSLNGEWR 219 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWR 114 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 67 PFASWRNSEEARTDRPSQQLRSLNGEWR 94 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 42 PFASWRNSEEARTDRPSQQLRSLNGEWR 69 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWR 85 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 104 PFASWRNSEEARTDRPSQQLRSLNGEWR 131 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWR 109 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWR 86 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 130 PFASWRNSEEARTDRPSQQLRSLNGEWR 157 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEWR 98 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEWR 88 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 144 PFASWRNSEEARTDRPSQQLRSLNGEWR 171 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 177 PFASWRNSEEARTDRPSQQLRSLNGEWR 204 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 127 PFASWRNSEEARTDRPSQQLRSLNGEWR 154 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWR 86 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 51 PFASWRNSEEARTDRPSQQLRSLNGEWR 78 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 120 PFASWRNSEEARTDRPSQQLRSLNGEWR 147 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWEN GVTQLNRLAAHP Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHP 119 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 510 PFASWRNSEKARTDRPSQQLRSLNGEWQ 593 PFASWRNSE+ARTDRPSQQLRSLNGEW+ Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEWR 107 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 436 LAVVLQRRDWENPGVTQLNRLAAHP 510 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,630,537 Number of Sequences: 59808 Number of extensions: 481848 Number of successful extensions: 8265 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8208 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -