BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0422 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 121 2e-29 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 121 bits (292), Expect = 2e-29 Identities = 56/80 (70%), Positives = 69/80 (86%) Frame = +1 Query: 13 TKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM 192 +K+IKA E D+FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+ Sbjct: 5 SKVIKAGNGEPDAFETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPV 64 Query: 193 PKLKAFQKIQIRLVRELEKK 252 PK KAFQK+Q RLVRELEKK Sbjct: 65 PKQKAFQKVQTRLVRELEKK 84 Score = 68.1 bits (159), Expect = 3e-13 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 386 K+ SGKHVVF+ +R+ILPKP R NKQKRPRS +T+VYDAILE Sbjct: 83 KKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVYDAILE 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,299 Number of Sequences: 2352 Number of extensions: 15662 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -