BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0414 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 28 0.33 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 23 9.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.5 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 27.9 bits (59), Expect = 0.33 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 529 ITLHKVIPKFDPIGNPISSIK*YSSCIAISYSNY 428 I + ++ K+D N +S IK Y +C+A+ Y Sbjct: 124 IIIANILQKYDVHSNDLSLIKMYPACVAVPPDTY 157 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 555 EYYFLLVVGPLVSPHG 602 E Y LL GP +PHG Sbjct: 236 EQYVLLPAGPPCAPHG 251 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 645 HYCFTAEIGRVVLPTRADSQEVLPPVKN 562 H F AEIG ++ DS E+LP N Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPAN 966 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,648 Number of Sequences: 2352 Number of extensions: 11927 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -