BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0410 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37830| Best HMM Match : Peptidase_C54 (HMM E-Value=3.3e-11) 29 3.5 SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) 28 6.2 >SB_37830| Best HMM Match : Peptidase_C54 (HMM E-Value=3.3e-11) Length = 878 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 275 SVTKVDPTRDFRFMYVVKQRQPRSHGCSITK 183 SV ++ ++DF F +V+K Q RS C IT+ Sbjct: 385 SVKRLFVSQDFGFTWVLKDEQVRSFFCQITR 415 >SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) Length = 702 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 305 RPCPPAFQKEPKELVEVKHRM 367 RPC P +Q+ P+ V HR+ Sbjct: 678 RPCQPCYQRNPRGAVHENHRL 698 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,220,352 Number of Sequences: 59808 Number of extensions: 467673 Number of successful extensions: 910 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -