BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0409 (707 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RB33 Cluster: F-box domain, putative; n=1; Plasmodium... 33 6.9 >UniRef50_Q7RB33 Cluster: F-box domain, putative; n=1; Plasmodium yoelii yoelii|Rep: F-box domain, putative - Plasmodium yoelii yoelii Length = 573 Score = 33.1 bits (72), Expect = 6.9 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Frame = +2 Query: 440 VRN*YMNVYKKRNYLTVKVEI*RTSNSPVDRFA-QAVWSLIMFMTSIGK*HCGEWRNFYF 616 VRN ++K YLT +I S S VD F + ++ +TSI +C + N + Sbjct: 434 VRN--STIFKIPRYLTGLRKIKIASLSNVDNFCIREIFKYCKNLTSIDFSNCWKVNNSFC 491 Query: 617 HA*RELLGVLSYFSVFFFLCLCARKVGIRL 706 + + YF+++FFLC+ ++ + L Sbjct: 492 NVNGLEIASGKYFNIYFFLCIIKKETKVFL 521 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,107,492 Number of Sequences: 1657284 Number of extensions: 12404227 Number of successful extensions: 24081 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24077 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -