BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0409 (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl... 27 9.2 At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl... 27 9.2 >At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 490 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 566 MTSIGK*HCGEWRNFYFHA*RELLGVLSYFSVFFF--LCLCARKVG 697 +TS+ + GE N YFH+ +L VL F ++ + LC +VG Sbjct: 228 VTSVAQQVDGENPNLYFHSDDVILCVLPMFHIYALNSIMLCGLRVG 273 >At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 561 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 566 MTSIGK*HCGEWRNFYFHA*RELLGVLSYFSVFFF--LCLCARKVG 697 +TS+ + GE N YFH+ +L VL F ++ + LC +VG Sbjct: 228 VTSVAQQVDGENPNLYFHSDDVILCVLPMFHIYALNSIMLCGLRVG 273 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,098,671 Number of Sequences: 28952 Number of extensions: 276884 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -