BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0407 (585 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0195 + 6578384-6578629,6578710-6579300,6586302-6587512,658... 27 8.3 05_06_0174 - 26149663-26149885,26150353-26151701 27 8.3 >10_02_0195 + 6578384-6578629,6578710-6579300,6586302-6587512, 6587593-6587844,6587932-6588042,6588133-6588214, 6588299-6588382,6588464-6588658 Length = 923 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 413 NFPFSRKSLHYF*KYYKLIINGVSKQQVNQARTQEKTTKSL 535 NF FS K LH F K K+ IN V ++Q +KT S+ Sbjct: 656 NFAFSFKDLHAFLKMDKMDINLVGAWCLSQWVDAQKTGASI 696 >05_06_0174 - 26149663-26149885,26150353-26151701 Length = 523 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 322 SIATIYLKSGQLWNAIDRCLQ*T 390 S+ T++ + GQLW A RCL T Sbjct: 432 SVGTLFRRDGQLWLAGGRCLMVT 454 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,645,356 Number of Sequences: 37544 Number of extensions: 196568 Number of successful extensions: 301 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 301 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -