BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0406 (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 24 2.7 AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-b... 24 2.7 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 6.2 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 49 VRSTNRFLDKEVSGGIY 99 +R TNRF+ KE+S +Y Sbjct: 69 MRFTNRFVSKEISEKVY 85 >AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-binding protein OBPjj12 protein. Length = 119 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 49 VRSTNRFLDKEVSGGIY 99 +R TNRF+ KE+S +Y Sbjct: 69 MRFTNRFVSKEISEKVY 85 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.0 bits (47), Expect = 6.2 Identities = 15/71 (21%), Positives = 30/71 (42%) Frame = +1 Query: 169 IYGRSINLEWAPKIILESVYLLISSIHKRMNIFKLKLNVVFVAYLPYRKVYIFARIKCNK 348 ++ + +L+W +I+ LL I + ++ VV LPY ++ A+ Sbjct: 803 VWTEATDLQWCRRILDRVQRLLAQGITSAFHSTSCEVAVVLAGELPY---HLLAKEDARC 859 Query: 349 YEKYQRKGTSN 381 Y + Q S+ Sbjct: 860 YNRQQSSPDSS 870 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,033 Number of Sequences: 2352 Number of extensions: 9733 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -