Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0404
         (441 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P92067 Cluster: Transcription factor homolog; n=1; Trib...    31   8.3  

>UniRef50_P92067 Cluster: Transcription factor homolog; n=1;
           Tribolium castaneum|Rep: Transcription factor homolog -
           Tribolium castaneum (Red flour beetle)
          Length = 276

 Score = 31.5 bits (68), Expect = 8.3
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -2

Query: 245 IKIDLEKIVYYNSN*NRRELAVTRFEFFIQKIATY*RACELAGRPPFPSVVVKMYF 78
           + ++ + I  Y +   R +LA    EFF +   +  R CELA +   P   +K++F
Sbjct: 64  VNVNDQNIRRYRTAFTREQLARLEKEFFKENYVSRPRRCELAAQLNLPESTIKVWF 119


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 381,725,810
Number of Sequences: 1657284
Number of extensions: 6461552
Number of successful extensions: 14043
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13744
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14043
length of database: 575,637,011
effective HSP length: 93
effective length of database: 421,509,599
effective search space used: 22340008747
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)