BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0404 (441 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21145| Best HMM Match : MucBP (HMM E-Value=7.4) 27 5.2 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +1 Query: 220 TIFSKSILMWRAFDRLRRSRADLKV*FCISYHRIHKNIDFH*KRTE 357 T+ + +W+ D L+ L C H IH NI H + E Sbjct: 879 TVEEQDARLWKTLDLLKNKGLTLNKENCEGAHNIHDNIILHGRTVE 924 >SB_21145| Best HMM Match : MucBP (HMM E-Value=7.4) Length = 203 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 128 HKRVSTSRFFE*RTRNASRPALDDSSWNYNKRF 226 HKR+ST + A+ PALD+S +NY + Sbjct: 108 HKRLSTLSSDKETFDQAAPPALDESGYNYTVHY 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,567,594 Number of Sequences: 59808 Number of extensions: 198944 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -