BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0404 (441 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X60655-1|CAA43062.1| 407|Homo sapiens EVX1 protein. 29 9.4 U68782-1|AAB07598.1| 407|Homo sapiens EVX1 protein. 29 9.4 >X60655-1|CAA43062.1| 407|Homo sapiens EVX1 protein. Length = 407 Score = 28.7 bits (61), Expect = 9.4 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -2 Query: 215 YNSN*NRRELAVTRFEFFIQKIATY*RACELAGRPPFPSVVVKMYFP-KIANERFEPKNL 39 Y + R ++A EF+ + + R CELA P +K++F + ++ + + Sbjct: 186 YRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAM 245 Query: 38 T*PNPGGRA 12 T P+P A Sbjct: 246 TWPHPADPA 254 >U68782-1|AAB07598.1| 407|Homo sapiens EVX1 protein. Length = 407 Score = 28.7 bits (61), Expect = 9.4 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -2 Query: 215 YNSN*NRRELAVTRFEFFIQKIATY*RACELAGRPPFPSVVVKMYFP-KIANERFEPKNL 39 Y + R ++A EF+ + + R CELA P +K++F + ++ + + Sbjct: 186 YRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAM 245 Query: 38 T*PNPGGRA 12 T P+P A Sbjct: 246 TWPHPADPA 254 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,936,670 Number of Sequences: 237096 Number of extensions: 887652 Number of successful extensions: 1828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1828 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3602345922 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -