BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0404 (441 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82285-4|CAD56247.1| 392|Caenorhabditis elegans Hypothetical pr... 27 6.0 Z82285-3|CAD56246.1| 573|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z82285-4|CAD56247.1| 392|Caenorhabditis elegans Hypothetical protein T28F3.4b protein. Length = 392 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = +3 Query: 42 IFWLKTLVGDFWKIHFNYNTRKRRSSCKLTSASVRRDFLNKELETRHGQLSTILV 206 IF+ ++V W + + + S CK+ + RD+L+ + R + + LV Sbjct: 241 IFYFASIVSTIWSVCWFLTASNQPSKCKVMT-KTERDYLDANVVRRSNKTNRSLV 294 >Z82285-3|CAD56246.1| 573|Caenorhabditis elegans Hypothetical protein T28F3.4a protein. Length = 573 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = +3 Query: 42 IFWLKTLVGDFWKIHFNYNTRKRRSSCKLTSASVRRDFLNKELETRHGQLSTILV 206 IF+ ++V W + + + S CK+ + RD+L+ + R + + LV Sbjct: 241 IFYFASIVSTIWSVCWFLTASNQPSKCKVMT-KTERDYLDANVVRRSNKTNRSLV 294 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,941,316 Number of Sequences: 27780 Number of extensions: 161064 Number of successful extensions: 388 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -