BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0396 (452 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 25 5.4 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 25 5.4 SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces p... 24 9.5 SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|... 24 9.5 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.0 bits (52), Expect = 5.4 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +2 Query: 113 STCEVQASTFRPKF--PAHPV*YNLLQLYNAILTQI 214 STC+ A TF PKF NL L+ A++ QI Sbjct: 163 STCKYSAFTFLPKFLKEQFSKYANLFFLFTAVVQQI 198 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 25.0 bits (52), Expect = 5.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 117 LVKFRRLPSDQNSLRILYNITCFNFTTRFLHR 212 L+K +RLP N+L I + I N + R ++R Sbjct: 129 LIKTKRLPKPFNNLLIQFQIQVPNVSRRTVYR 160 >SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 24.2 bits (50), Expect = 9.5 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 72 GHQTDATSVKFQPNPLVKFR-RLPSDQNSLRILYNITCFNFTT 197 GH+ S++ P P+V R S+ N++RI ++++ N T Sbjct: 172 GHKRSIVSMEIGPGPIVSGRLYTASEDNTIRI-WDVSTGNLLT 213 >SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 24.2 bits (50), Expect = 9.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 323 PNPRVYPKHPVSHY 364 P PR+YP P+++Y Sbjct: 99 PQPRLYPSAPLNYY 112 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,772,127 Number of Sequences: 5004 Number of extensions: 33129 Number of successful extensions: 68 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 168258430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -