BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0396 (452 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95632-1|CAA64885.1| 475|Homo sapiens Arg protein tyrosine kina... 29 7.4 U31089-1|AAA75446.1| 390|Homo sapiens Abl binding protein 3 pro... 29 7.4 U23435-1|AAA92289.1| 401|Homo sapiens Abl interactor 2 protein. 29 7.4 BT009920-1|AAP88922.1| 475|Homo sapiens abl-interactor 2 protein. 29 7.4 BC001439-1|AAH01439.1| 475|Homo sapiens abl interactor 2 protein. 29 7.4 AC018891-1|AAY14675.1| 321|Homo sapiens unknown protein. 29 7.4 >X95632-1|CAA64885.1| 475|Homo sapiens Arg protein tyrosine kinase-binding protein protein. Length = 475 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 265 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 294 >U31089-1|AAA75446.1| 390|Homo sapiens Abl binding protein 3 protein. Length = 390 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 180 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 209 >U23435-1|AAA92289.1| 401|Homo sapiens Abl interactor 2 protein. Length = 401 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 220 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 249 >BT009920-1|AAP88922.1| 475|Homo sapiens abl-interactor 2 protein. Length = 475 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 265 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 294 >BC001439-1|AAH01439.1| 475|Homo sapiens abl interactor 2 protein. Length = 475 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 265 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 294 >AC018891-1|AAY14675.1| 321|Homo sapiens unknown protein. Length = 321 Score = 29.1 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 305 VAVVTSPNPRVYPKHPVSHYPLQLNNSIHT 394 +AV T P V+P HPV Y + S HT Sbjct: 111 IAVPTPSPPSVFPGHPVQFYSMNRPASRHT 140 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,815,781 Number of Sequences: 237096 Number of extensions: 1124449 Number of successful extensions: 2026 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2026 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -