BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0389 (490 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_7902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1020 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/68 (27%), Positives = 29/68 (42%) Frame = -1 Query: 241 GQLKLSILIYFVHKVQAAQTKPVTLT*AQCLDTIACILSKVSTTTGNLDL**HLKTTSQS 62 G L ++Y VH+V + P +T + +LS T N L+ +Q Sbjct: 60 GLLLTEAMVYAVHRVNHEKVLPFNMTLGLDIRDTCNLLSNALRATLNFV---ELRKHNQE 116 Query: 61 LNKNQATN 38 N +QATN Sbjct: 117 TNASQATN 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,954,513 Number of Sequences: 59808 Number of extensions: 223462 Number of successful extensions: 327 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -