BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0388 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.1 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 478 SPSKPCSRCTLRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 630 S ++ T +++HR C P +L +I + P HP + S S P Sbjct: 55 SGTRSSESLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 357 LRVAPEEHPVLLTEAPLNPKANREKMTHI 443 LR+ P H V+ T +NP + EK+ HI Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL-HI 1488 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 215 VWDRRTLM*EMRHKQKRYPD 274 VW+R T + + KQK +P+ Sbjct: 523 VWERDTRVLPINRKQKVFPN 542 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 121 GMCKAGFAGD 150 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,750 Number of Sequences: 438 Number of extensions: 5674 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -