BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0385 (708 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0187 + 21433842-21433887,21434504-21435246,21435437-214354... 29 3.6 06_03_0267 + 18970578-18972464 28 6.3 06_03_0143 + 17215975-17216745 28 6.3 >09_06_0187 + 21433842-21433887,21434504-21435246,21435437-21435484, 21435929-21436814,21436967-21437056,21437543-21438417 Length = 895 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 168 FISRMNPYSPELNYFLSYQY 227 FI R+ +SP++ YF SY+Y Sbjct: 190 FIGRLPEWSPDVRYFTSYEY 209 >06_03_0267 + 18970578-18972464 Length = 628 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -2 Query: 509 RRCVVEQCFLVVRLEGPCCHQHAGQEHRWAVSACS*KSH*MADRCSS 369 +RCVV C R CC +H G + R + CS + D C + Sbjct: 447 KRCVVPGCTKSARGRTDCCVRHGGGK-RCQFTGCSKSAQGSTDFCKA 492 >06_03_0143 + 17215975-17216745 Length = 256 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 503 CVVEQCFLVVRLEGPCCHQHAGQEHRWAVSACS 405 C V C+ VRL P C AG+ R ACS Sbjct: 202 CDVPFCYCRVRLRRPACAAPAGRAARRLEKACS 234 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,825,789 Number of Sequences: 37544 Number of extensions: 433194 Number of successful extensions: 1004 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1004 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -