BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0384 (508 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 117 5e-27 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 117 6e-27 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 117 6e-27 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 116 8e-27 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 116 8e-27 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 113 6e-26 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 112 2e-25 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 111 2e-25 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 101 3e-22 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 60 1e-09 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 50 1e-06 12_02_1282 + 27528159-27529148,27529549-27529614 50 1e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 47 1e-05 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 45 3e-05 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 44 9e-05 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 37 0.008 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 31 0.40 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 29 1.6 08_02_0309 - 15622877-15623710 29 2.1 12_01_0748 - 6728221-6728305,6728788-6728842,6729202-6729289,672... 28 5.0 08_01_0927 - 9123473-9123589,9124534-9124616,9125177-9125252,912... 28 5.0 01_07_0383 - 43195095-43195322,43195408-43195638,43196134-431964... 27 6.5 07_03_0463 - 18449908-18450171,18450718-18450810,18451170-184512... 27 8.7 04_03_0819 + 20018496-20019487,20019587-20019721,20019834-200199... 27 8.7 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 117 bits (282), Expect = 5e-27 Identities = 55/69 (79%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWISK EYDESG Sbjct: 306 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 365 Query: 296 PSIVHRKCF 270 PSIVHRKCF Sbjct: 366 PSIVHRKCF 374 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 117 bits (281), Expect = 6e-27 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWISK EYDESG Sbjct: 309 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESG 368 Query: 296 PSIVHRKCF 270 P+IVHRKCF Sbjct: 369 PAIVHRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 117 bits (281), Expect = 6e-27 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWISK EYDESG Sbjct: 309 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESG 368 Query: 296 PSIVHRKCF 270 P+IVHRKCF Sbjct: 369 PAIVHRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 116 bits (280), Expect = 8e-27 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWISK EYDESG Sbjct: 312 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESG 371 Query: 296 PSIVHRKCF 270 P+IVHRKCF Sbjct: 372 PAIVHRKCF 380 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 116 bits (280), Expect = 8e-27 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWI+K EYDESG Sbjct: 309 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESG 368 Query: 296 PSIVHRKCF 270 PSIVHRKCF Sbjct: 369 PSIVHRKCF 377 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 113 bits (273), Expect = 6e-26 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQQMWIS+ EY+ESG Sbjct: 309 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESG 368 Query: 296 PSIVHRKCF 270 P+IVHRKCF Sbjct: 369 PAIVHRKCF 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 112 bits (269), Expect = 2e-25 Identities = 52/69 (75%), Positives = 59/69 (85%), Gaps = 3/69 (4%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESG 297 P + R S+ +LAPS+MK+K+IAPP+RKYSVWIGGSILASLSTFQQMWISK EYDESG Sbjct: 308 PGIADRMSKEITSLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 367 Query: 296 PSIVHRKCF 270 P IVH KCF Sbjct: 368 PGIVHMKCF 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 111 bits (268), Expect = 2e-25 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -3 Query: 440 ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 270 ALAP +MKIK++APP+RKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF Sbjct: 320 ALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 101 bits (242), Expect = 3e-22 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 17/83 (20%) Frame = -3 Query: 467 PPVCKRKSQ---ALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQ------------- 336 P + R S+ ALAPS+MKIK++APP+RKYSVWIGGSILASLSTFQ Sbjct: 309 PGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVAR 368 Query: 335 -QMWISKQEYDESGPSIVHRKCF 270 QMWISK EYDESGP+IVHRKCF Sbjct: 369 MQMWISKGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 59.7 bits (138), Expect = 1e-09 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -3 Query: 446 SQALAPSTMKIKIIAPPK-RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 270 + A+ PS +K P +YS W+GG+ILA + Q ++K +YDE+GPSIVH+KCF Sbjct: 339 ASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 3/39 (7%) Frame = -3 Query: 419 KIKIIAPP---KRKYSVWIGGSILASLSTFQQMWISKQE 312 ++K++A +R++SVWIGGSILASL +FQQMW SK + Sbjct: 431 RVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAD 469 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -3 Query: 359 LASLSTFQQMWISKQEYDESGPSIVHRKCF 270 LA S +MWI+K EYDESGPSIVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/45 (40%), Positives = 32/45 (71%) Frame = -3 Query: 422 MKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 288 +++ +++ P ++Y+VW GGS+LAS + F + +K EY+E G SI Sbjct: 418 IEVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = -3 Query: 455 KRKSQALAPSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 276 +++ + L P ++KIIA W GGS+LA F+ M I+K EY+E G R+ Sbjct: 367 EKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRR 426 Query: 275 CF 270 F Sbjct: 427 FF 428 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 43.6 bits (98), Expect = 9e-05 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = -3 Query: 422 MKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 288 +++ ++A P + Y+ W GGS+ AS F + +K+EY+E G SI Sbjct: 385 VEVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 37.1 bits (82), Expect = 0.008 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 6/81 (7%) Frame = -3 Query: 506 VLSGWYPHVPLESPPVCKRKSQAL-APSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQM 330 VLSG +P S + K + L A + I++I PP S W G +++++STF + Sbjct: 402 VLSGGSSCLPGLSERLEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEA 461 Query: 329 W-ISKQEYDE----SGPSIVH 282 W I K+++ + +GPS V+ Sbjct: 462 WCIKKKQFRQKTRRNGPSFVN 482 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 31.5 bits (68), Expect = 0.40 Identities = 10/25 (40%), Positives = 21/25 (84%) Frame = -3 Query: 422 MKIKIIAPPKRKYSVWIGGSILASL 348 ++++I PP+RK+ V++GG++LA + Sbjct: 366 LRLRIEDPPRRKHMVYLGGAVLAGI 390 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -3 Query: 431 PSTMKIKIIAPPKRKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 276 P +K++ W G + A+ S F + S +Y E G ++ HRK Sbjct: 651 PYLSPLKLVRAADPLIDAWRGAAAFAASSKFGRHTFSLADYREHGENLFHRK 702 >08_02_0309 - 15622877-15623710 Length = 277 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 437 EPVISFCIPAAIPGVHGGTTRTIP 508 +P+ ++C+ + HGGT RT+P Sbjct: 169 DPLHAYCVATTLVAQHGGTWRTLP 192 >12_01_0748 - 6728221-6728305,6728788-6728842,6729202-6729289, 6729681-6729818,6729978-6730142,6730235-6730354, 6730555-6730631,6730738-6731113,6731523-6732617 Length = 732 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 333 LLEGREGGEDRSTDPYRVLPLWRSNDLNLHCRWGESL 443 +L+ E S P +LPL NDL+ RWG L Sbjct: 402 VLDAIEKQNYESPPPVSILPLGTGNDLSRVMRWGGGL 438 >08_01_0927 - 9123473-9123589,9124534-9124616,9125177-9125252, 9125641-9125740,9125996-9126064,9126122-9126207, 9126293-9126430,9126688-9126810,9128130-9129719, 9129929-9130402 Length = 951 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 375 PYRVLPLWRSNDLNLHCRWGESL*FPFAYR 464 P V+PL NDL+ WG S FPF ++ Sbjct: 757 PVAVIPLGTGNDLSRSFGWGAS--FPFGWK 784 >01_07_0383 - 43195095-43195322,43195408-43195638,43196134-43196454, 43196512-43196589,43196664-43197727,43197813-43198503, 43198743-43199541,43200010-43200158,43200159-43200286, 43200389-43200494,43200835-43200843,43201332-43201821, 43201896-43202554,43203759-43203851,43204044-43204196, 43205092-43205194,43205376-43205467,43206229-43206306, 43206987-43207049,43207339-43207512 Length = 1902 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 Query: 474 GIAAGMQKEITGSRPIDNED*DHCSSKEEVLGMDRWIDPRLPLYLPTDVDLE 319 G+AA + G+ PI H +S+ E DP + LP DVD E Sbjct: 12 GLAASLLPHAQGAVPIVGFGGYHGASRVEPAAPSSSTDPDASILLPPDVDSE 63 >07_03_0463 - 18449908-18450171,18450718-18450810,18451170-18451254, 18451607-18451705,18452099-18452238,18453036-18453482 Length = 375 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 169 ITIISYVQLN*RRLQA*IEQPAAGCWR 249 +T + +V L RLQ +E PAA CWR Sbjct: 245 LTFVPFVVL---RLQKFLESPAATCWR 268 >04_03_0819 + 20018496-20019487,20019587-20019721,20019834-20019978, 20020135-20020416,20020649-20020910,20021028-20021224, 20021315-20021425,20022341-20022392,20022442-20022584, 20023121-20023210,20023300-20023800,20024108-20024176, 20024866-20025011,20025475-20025530,20026140-20026286, 20027405-20027530,20027608-20027876,20028026-20028127 Length = 1274 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 381 RVLPLWRSNDLNLHCRWGESL*FPFAYR 464 R L LWR ++ H +W E+L F YR Sbjct: 699 RSLGLWRLEEVLSHFKWPETLETDFFYR 726 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,357,052 Number of Sequences: 37544 Number of extensions: 260204 Number of successful extensions: 704 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -