BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0381 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 24 2.5 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 24 2.5 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 24 2.5 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 5.8 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 7.6 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 7.6 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 63 ERIPERVVHAKGAGAFGYFEVTHDI 87 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 267 DRVPEYVLHFRGTDVFASHQVVNQL 193 +R+PE V+H +G F +V + + Sbjct: 47 ERIPERVVHAKGAGAFGYFEVTHDI 71 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 5.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 207 PDERQIHPFRGSGERIPALDRADYMSLESTGSGV 308 P R + P S + PAL++A LES G+ + Sbjct: 552 PRARTMPPKGCSHDDGPALEKAQLYQLESDGTAI 585 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 376 YFHCKRHGC*NMQRSIPPGKI 314 Y H +RHG +++ IP G I Sbjct: 21 YSHWERHGLPHLKPEIPYGNI 41 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 376 YFHCKRHGC*NMQRSIPPGKI 314 Y H +RHG +++ IP G I Sbjct: 21 YSHWERHGLPHLKPEIPYGNI 41 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,528 Number of Sequences: 2352 Number of extensions: 11826 Number of successful extensions: 31 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -