BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0381 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39996-6|AAA81092.1| 595|Caenorhabditis elegans Hypothetical pr... 27 5.7 U67949-7|AAD32275.1| 149|Caenorhabditis elegans Hypothetical pr... 27 7.6 >U39996-6|AAA81092.1| 595|Caenorhabditis elegans Hypothetical protein C56E6.5 protein. Length = 595 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 265 SSAGIRSPLPRNGCICLSSGCQSTHYYHALNSLHLPFLMILFYHHLYEEL 116 SS +RS L + +CLSS S H ++ L F +I + H E+L Sbjct: 106 SSLSVRSLLYYHARLCLSSTHTSLEIDHRISELSAMFDVIGYAHDKLEDL 155 >U67949-7|AAD32275.1| 149|Caenorhabditis elegans Hypothetical protein F55A4.7 protein. Length = 149 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 330 FLQARSFIRLIRYFLKTCNRHDR---VPEYVLHFRGTDVFASHQ 208 FL+ R IR + Y K +H R +P Y+ G++ FAS + Sbjct: 19 FLEIRVIIRNMEYAKKQAEKHKRKIILPSYISWEYGSNKFASQK 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,037,194 Number of Sequences: 27780 Number of extensions: 263943 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -