BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0375 (562 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 4.1 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 18 TQSTEFLVESSQWVAFPIRW*IQRSTAFAKA 110 TQ + + QWVAF I +AK+ Sbjct: 318 TQKNTHMYKGDQWVAFDSPKAISNKVEYAKS 348 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 245 DRHECWKGQTGKHEGL 292 D W G TG H GL Sbjct: 208 DLRGSWDGVTGHHSGL 223 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,110 Number of Sequences: 336 Number of extensions: 2885 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -