BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0371 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 3e-16 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 3e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 7e-16 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 80 2e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 78 5e-15 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 78 5e-15 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 78 5e-15 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 76 2e-14 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 74 8e-14 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 5e-12 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 62 3e-10 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 62 3e-10 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 62 3e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 62 3e-10 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 62 3e-10 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 62 3e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 62 3e-10 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 62 3e-10 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 62 3e-10 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 62 3e-10 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 62 3e-10 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 62 3e-10 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 62 3e-10 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 62 3e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 60 2e-09 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 2e-09 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 58 4e-09 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 58 4e-09 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 58 4e-09 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 58 4e-09 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 58 4e-09 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 58 4e-09 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 58 4e-09 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 58 4e-09 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 58 4e-09 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 58 4e-09 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 58 4e-09 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 58 4e-09 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 58 4e-09 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 58 4e-09 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 58 4e-09 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 58 4e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 58 4e-09 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 58 4e-09 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 58 4e-09 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 58 4e-09 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 58 4e-09 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 58 4e-09 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 58 4e-09 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 58 4e-09 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 58 4e-09 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 58 4e-09 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 58 4e-09 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 58 4e-09 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 58 4e-09 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 58 4e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 58 4e-09 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 58 4e-09 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 58 4e-09 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 58 4e-09 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 58 4e-09 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 58 4e-09 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 58 4e-09 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 58 4e-09 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 58 4e-09 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 58 4e-09 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 58 4e-09 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 58 4e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 58 4e-09 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 58 4e-09 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 58 4e-09 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 58 4e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 58 4e-09 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 58 4e-09 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 58 4e-09 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 58 4e-09 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 58 4e-09 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 58 4e-09 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 58 4e-09 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 58 4e-09 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 58 4e-09 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 58 4e-09 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 58 4e-09 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 58 4e-09 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 58 4e-09 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 58 4e-09 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 58 4e-09 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 58 4e-09 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 58 4e-09 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 58 4e-09 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 58 4e-09 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 58 4e-09 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 58 4e-09 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 58 4e-09 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 58 4e-09 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 58 5e-09 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 58 5e-09 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 58 7e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 57 9e-09 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 57 9e-09 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 57 9e-09 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 57 9e-09 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 57 9e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 57 9e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 57 9e-09 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 57 9e-09 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 57 9e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 57 9e-09 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 57 9e-09 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 57 9e-09 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 57 9e-09 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 57 9e-09 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 57 9e-09 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/63 (66%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = +1 Query: 406 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHTPFRQLA**RKGPHRS-PFQQLRNLN 582 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQH P + P QQLR+LN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 583 GEW 591 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/61 (68%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = +1 Query: 412 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHTPFRQLA**RKGPHRS-PFQQLRNLNGE 588 P +SRITIHWPSFYNVVTGKTLALPNLIALQH P R+ P QQLR+LNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 589 W 591 W Sbjct: 137 W 137 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 3e-16 Identities = 41/58 (70%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIALQH-TPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNLIALQH PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 82.2 bits (194), Expect = 3e-16 Identities = 41/59 (69%), Positives = 42/59 (71%) Frame = -2 Query: 579 QVAQLLERRSVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 403 Q+ E RSVRA SLLRQLAKGG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.0 bits (191), Expect = 7e-16 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIALQHTPFRQLA**RKGPHRS-PFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNLIALQH P + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 80.6 bits (190), Expect = 9e-16 Identities = 40/58 (68%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIALQ-HTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNLIALQ H PF + P Q+LR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 79.8 bits (188), Expect = 2e-15 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNLIAL H PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 79.8 bits (188), Expect = 2e-15 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIALQHTPFRQLA**RKGPHRSPF-QQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNLIALQH P K P +QLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.0 bits (186), Expect = 3e-15 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = -2 Query: 579 QVAQLLERR-SVRAFSLLRQLAKGGVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRAN 406 Q AQLL R F++ KG VLQGD +G RQGFPSHDVVKRRPVNCNTTHYRAN Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRAN 101 Query: 405 W 403 W Sbjct: 102 W 102 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 403 E RSVRA SLLRQLAKGG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 599 EGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 648 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 617 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 403 E RSVRA SLLRQLAKGG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 60 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 403 E RSVRA SLLRQLAKGG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 60 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 76.2 bits (179), Expect = 2e-14 Identities = 41/69 (59%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +1 Query: 388 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQ 564 GGA PIRPIVSRITIHWP+FYN TGKTLA L L H PF ++ P Q Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQ 93 Query: 565 QLRNLNGEW 591 QLR+LNGEW Sbjct: 94 QLRSLNGEW 102 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 76.2 bits (179), Expect = 2e-14 Identities = 37/58 (63%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIALQHTP-FRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTLALPNL L+H P + + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 74.1 bits (174), Expect = 8e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 450 LQRRDWENPGVTQLNRLAAHPLSPAGVIAKRPAPIAFPTVAQPEWRM 590 LQRRDWENPGVTQLNRLAAHP + ++RP FPTVAQPEWRM Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRM 394 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.5 bits (170), Expect = 2e-13 Identities = 35/54 (64%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 436 HWPSFYNVVTGKTLALPNLIALQHTPFRQLA**RKGPHRS-PFQQLRNLNGEWQ 594 HWPSFYNVVTGKTLALPNLIALQH P + P QQLR+LNGEW+ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWR 58 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 70.5 bits (165), Expect = 9e-13 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -2 Query: 594 LPFAIQVAQLLERR-SVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTH 418 +PFAIQ AQLL R F++ +G + +G FPSHDVVKRRPVNCNTTH Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTH 62 Query: 417 YRANW 403 YRANW Sbjct: 63 YRANW 67 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 68.1 bits (159), Expect = 5e-12 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNCW+GDRCGP RYYASWRKG Sbjct: 32 HSPFRLRNCWEGDRCGPLRYYASWRKG 58 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.9 bits (156), Expect = 1e-11 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGKTL++ L L H PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 65.3 bits (152), Expect = 4e-11 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 565 VGKAIGAGLFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 437 +G+AIGAGLF ITPA ERG ARRLSWV P FSQS RC AS Sbjct: 15 LGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 65.3 bits (152), Expect = 4e-11 Identities = 34/64 (53%), Positives = 38/64 (59%) Frame = -2 Query: 594 LPFAIQVAQLLERRSVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHY 415 +PFAIQ AQLL R + + G+ FPSHDVVKRRPVNCNTTHY Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVFPSHDVVKRRPVNCNTTHY 1895 Query: 414 RANW 403 RANW Sbjct: 1896 RANW 1899 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 64.5 bits (150), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNC KGDRCGP RYYASWRKG Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKG 30 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 64.5 bits (150), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNC KGDRCGP RYYASWRKG Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKG 30 >SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 64.5 bits (150), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNC KGDRCGP RYYASWRKG Sbjct: 11 HSPFRLRNCGKGDRCGPLRYYASWRKG 37 >SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 64.5 bits (150), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNC KGDRCGP RYYASWRKG Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKG 30 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 480 RQGFPSHDVVKRRPVNCNTTHYRANW 403 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 33.1 bits (72), Expect = 0.17 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -3 Query: 590 HSPFRLRNCWKG 555 HSPFRLRNCW+G Sbjct: 43 HSPFRLRNCWEG 54 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.9 bits (146), Expect = 2e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 489 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 403 +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 48.8 bits (111), Expect = 3e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -3 Query: 560 KGDRCGPFRYYASWRKGVCCKAIKLGNARVFP 465 KGDRCG F + +G+CCKAIKLGNA+ FP Sbjct: 7 KGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -1 Query: 574 CATVGKAIGAGLFAITPAGERGCAARRL 491 CATVGK GLFAITPAGERG + + Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAI 29 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.5 bits (145), Expect = 2e-10 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGK + L L H PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.5 bits (145), Expect = 2e-10 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGK + L L H PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 243 GCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 244 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 911 GCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 33.1 bits (72), Expect = 0.17 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 579 QVAQLLERRSVRAFSLLRQLAKGG 508 Q+ E RSVRA SLLRQLAKGG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGG 911 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 GCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 36.7 bits (81), Expect = 0.014 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 573 AQLLERRSVRAFSLLRQLAKGG 508 AQL E RSVRA SLLRQLAKGG Sbjct: 2 AQLWEGRSVRASSLLRQLAKGG 23 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 398 GCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 399 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 230 EGRSVRASSLLRQLAKGG 247 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 314 GCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 315 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 380 GCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 363 EGRSVRASSLLRQLAKGG 380 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 72 GCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 55 EGRSVRASSLLRQLAKGG 72 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNC +G KG C Sbjct: 45 HSPFRLRNCGEGRSVRASSLLRQLAKGGC 73 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 54 GCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 55 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 290 GCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 273 EGRSVRASSLLRQLAKGG 290 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 257 EGRSVRASSLLRQLAKGG 274 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 263 GCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 33.1 bits (72), Expect = 0.17 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -2 Query: 582 IQVAQLLERRSVRAFSLLRQLAKGG 508 I++ E RSVRA SLLRQLAKGG Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGG 263 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 GCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 289 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 472 GCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 473 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 124 EGRSVRASSLLRQLAKGG 141 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 307 GCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 308 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 157 GCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 158 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 350 GCAARRLSWVTPGFSQSRRCKTTASEL 376 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 555 RSVRAFSLLRQLAKGG 508 RSVR +SLLRQL KGG Sbjct: 335 RSVRTYSLLRQLVKGG 350 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 GCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 555 RSVRAFSLLRQLAKGG 508 RSVRA SLLRQLAKGG Sbjct: 2 RSVRASSLLRQLAKGG 17 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 216 GCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 199 EGRSVRASSLLRQLAKGG 216 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 608 GCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 609 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 244 GCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 227 EGRSVRASSLLRQLAKGG 244 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 84 GCAARRLSWVTPGFSQSRRCKTTASEL 110 Score = 44.4 bits (100), Expect = 7e-05 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 560 KGDRCGPFRYYASWRKGVC 504 +GDRCGP RYYASWRKG C Sbjct: 67 QGDRCGPLRYYASWRKGGC 85 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 522 GCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 523 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 105 GCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 88 EGRSVRASSLLRQLAKGG 105 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 413 GCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 396 EGRSVRASSLLRQLAKGG 413 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 GCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 555 RSVRAFSLLRQLAKGG 508 RSVRA SLLRQLAKGG Sbjct: 2 RSVRASSLLRQLAKGG 17 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 206 GCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 207 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 4e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 474 GFPSHDVVKRRPVNCNTTHYRANW 403 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 61.7 bits (143), Expect = 4e-10 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGK + L L H PF + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 416 GCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 31 GCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 57.2 bits (132), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 438 LAVVLQRRDWENPGVTQLNRLAAHP 512 LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 509 PPFASWRNSEKARTDRLS 562 PPFASWRNSE+ARTDR S Sbjct: 109 PPFASWRNSEEARTDRPS 126 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 32 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 505 HTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 H PF + P QQLR+LNGEW Sbjct: 108 HPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 61.3 bits (142), Expect = 6e-10 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 5/52 (9%) Frame = -1 Query: 577 GCATVGKAIGAG-----LFAITPAGERGCAARRLSWVTPGFSQSRRCKTTAS 437 G + KA+G G F TP G CAARRLSWVTPGFSQSRRCKTTAS Sbjct: 310 GSGEIRKAMGIGPGVQQQFKFTPGG---CAARRLSWVTPGFSQSRRCKTTAS 358 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 60.5 bits (140), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASE 434 GCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 553 GCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 34.3 bits (75), Expect = 0.075 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 591 PFAIQVAQLLERRSVRAFSLLRQLAKGG 508 P+ ++ E RSVRA SLLRQLAKGG Sbjct: 526 PYTQRLRNCWEGRSVRASSLLRQLAKGG 553 >SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 60.5 bits (140), Expect = 1e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKG 510 HSPFRLRNC KGDRCG RYYASWRKG Sbjct: 4 HSPFRLRNCGKGDRCGLLRYYASWRKG 30 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 59.7 bits (138), Expect = 2e-09 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = -2 Query: 582 IQVAQLLERR-SVRAFSLLRQLAKGGVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 406 +Q AQLL R F++ +G + + FPSHDVVKRRPVNCNTTHYRAN Sbjct: 1 MQAAQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRAN 60 Query: 405 W 403 W Sbjct: 61 W 61 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 436 HWPSFYNVVTGKTLALPNLIALQHTP 513 HWPSFYNVVTGKTLALPNLIALQH P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +3 Query: 510 PLSPAGVIAKRPAPIAFP 563 PLSPAGVIAKRPAPIA P Sbjct: 87 PLSPAGVIAKRPAPIALP 104 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 436 HWPSFYNVVTGKTLALPNLIALQHTP 513 HWPSFYNVVTGKTLALPNLIALQH P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +3 Query: 510 PLSPAGVIAKRPAPIAFP 563 PLSPAGVIAKRPAPIA P Sbjct: 82 PLSPAGVIAKRPAPIALP 99 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 471 FPSHDVVKRRPVNCNTTHYRANW 403 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 471 FPSHDVVKRRPVNCNTTHYRANW 403 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 545 GPFRYYASWRKGVCCKAIKLGNARVFP 465 G F + +G+CCKAIKLGNA VFP Sbjct: 6 GLFAITPAGERGMCCKAIKLGNASVFP 32 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 556 AIGAGLFAITPAGERGCAARRL 491 AIGAGLFAITPAGERG + + Sbjct: 2 AIGAGLFAITPAGERGMCCKAI 23 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.3 bits (137), Expect = 2e-09 Identities = 31/58 (53%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGKTLALPNLIAL-QHTPFRQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNV+ KT + L L H PF K P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 59 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 509 PPFASWRNSEKARTDRLS 562 PPFASWRNSEKARTDR S Sbjct: 32 PPFASWRNSEKARTDRPS 49 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 58.8 bits (136), Expect = 3e-09 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +1 Query: 421 SRITIHWPSFYNVVTGK-TLALPNLIALQHTPF-RQLA**RKGPHRSPFQQLRNLNGEW 591 SRITIHWPSFYNVVTGK T P+L LQ+ P + P QQLR+LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 499 GCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 500 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 169 GCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 152 EGRSVRASSLLRQLAKGG 169 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 246 GCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 229 EGRSVRASSLLRQLAKGG 246 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 390 GCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 373 EGRSVRASSLLRQLAKGG 390 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 92 GCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 93 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 673 GCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 674 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 179 GCAARRLSWVTPGFSQSRRCKTTAS 203 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 58.4 bits (135), Expect = 4e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTASEL 431 GCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 23 GCAARRLSWVTPVFSQSRRCKTTASEL 49 Score = 36.7 bits (81), Expect = 0.014 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 573 AQLLERRSVRAFSLLRQLAKGG 508 AQL E RSVRA SLLRQLAKGG Sbjct: 2 AQLWEGRSVRASSLLRQLAKGG 23 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 582 GCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 583 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 429 GCAARRLSWVTPGFSQSRRCKTTAS 453 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 412 EGRSVRASSLLRQLAKGG 429 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 56 GCAARRLSWVTPGFSQSRRCKTTAS 80 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 39 EGRSVRASSLLRQLAKGG 56 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 812 GCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 795 EGRSVRASSLLRQLAKGG 812 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 473 GCAARRLSWVTPGFSQSRRCKTTAS 497 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 456 EGRSVRASSLLRQLAKGG 473 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 92 GCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 75 EGRSVRASSLLRQLAKGG 92 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRN W+G KG C Sbjct: 65 HSPFRLRNYWEGRSVRASSLLRQLAKGGC 93 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -2 Query: 591 PFAIQVAQLLERRSVRAFSLLRQLAKGG 508 PFAIQ AQL E RSVRA SLLRQLAKGG Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQLAKGG 38 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 394 GCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 377 EGRSVRASSLLRQLAKGG 394 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1128 GCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 1111 EGRSVRASSLLRQLAKGG 1128 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 319 GCAARRLSWVTPGFSQSRRCKTTAS 343 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 302 EGRSVRASSLLRQLAKGG 319 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 133 GCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 116 EGRSVRASSLLRQLAKGG 133 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 43 GCAARRLSWVTPGFSQSRRCKTTAS 67 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 26 EGRSVRASSLLRQLAKGG 43 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 5 GCAARRLSWVTPGFSQSRRCKTTAS 29 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 17 GCAARRLSWVTPGFSQSRRCKTTAS 41 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 555 RSVRAFSLLRQLAKGG 508 RSVRA SLLRQLAKGG Sbjct: 2 RSVRASSLLRQLAKGG 17 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 59 GCAARRLSWVTPGFSQSRRCKTTAS 83 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 60 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 591 PFAIQVAQLLERRSVRAFSLLRQLAKGG 508 PFAIQ AQLLE RSVRA SLLRQLAKGG Sbjct: 11 PFAIQAAQLLEGRSVRASSLLRQLAKGG 38 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 509 GCAARRLSWVTPGFSQSRRCKTTAS 533 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 492 EGRSVRASSLLRQLAKGG 509 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 117 GCAARRLSWVTPGFSQSRRCKTTAS 141 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 100 EGRSVRASSLLRQLAKGG 117 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 77 GCAARRLSWVTPGFSQSRRCKTTAS 101 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 60 EGRSVRASSLLRQLAKGG 77 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA+SL RQLAKGG Sbjct: 7 EGRSVRAYSLFRQLAKGG 24 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 79 GCAARRLSWVTPGFSQSRRCKTTAS 103 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -2 Query: 591 PFAIQVAQLLERRSVRAFSLLRQLAKGG 508 P A ++ E RSVRA SLLRQLAKGG Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGG 79 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.4 bits (135), Expect = 4e-09 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = +3 Query: 378 HSSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 512 HSSR G LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 36 HSSRSGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 79 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 509 PPFASWRNSEKARTDRLS 562 PPFASWRNSE+ARTDR S Sbjct: 79 PPFASWRNSEEARTDRPS 96 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 505 HTPFRQLA**RKGPHRSPFQQLRNLNGEWQ 594 H PF + P QQLR+LNGEW+ Sbjct: 78 HPPFASWRNSEEARTDRPSQQLRSLNGEWR 107 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 73 GCAARRLSWVTPGFSQSRRCKTTAS 97 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 56 EGRSVRASSLLRQLAKGG 73 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 178 GCAARRLSWVTPGFSQSRRCKTTAS 202 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 161 EGRSVRASSLLRQLAKGG 178 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 GCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 39 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 215 GCAARRLSWVTPGFSQSRRCKTTAS 239 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 216 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 151 GCAARRLSWVTPGFSQSRRCKTTAS 175 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 134 EGRSVRASSLLRQLAKGG 151 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 122 GCAARRLSWVTPGFSQSRRCKTTAS 146 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -2 Query: 594 LPFA--IQVAQLLERRSVRAFSLLRQLAKGG 508 +PF +++ E RSVRA SLLRQLAKGG Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGG 122 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 78 GCAARRLSWVTPGFSQSRRCKTTAS 102 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 61 EGRSVRASSLLRQLAKGG 78 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 GCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 590 HSPFRLRNCWKGDRCGPFRYYASWRKGVC 504 HSPFRLRNCW+G KG C Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGC 47 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 17 GCAARRLSWVTPGFSQSRRCKTTAS 41 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 555 RSVRAFSLLRQLAKGG 508 RSVRA SLLRQLAKGG Sbjct: 2 RSVRASSLLRQLAKGG 17 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 58.4 bits (135), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 511 GCAARRLSWVTPGFSQSRRCKTTAS 437 GCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 GCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 561 ERRSVRAFSLLRQLAKGG 508 E RSVRA SLLRQLAKGG Sbjct: 7 EGRSVRASSLLRQLAKGG 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,174,674 Number of Sequences: 59808 Number of extensions: 440512 Number of successful extensions: 12097 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11861 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -