BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0371 (595 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39853-4|AAK39224.1| 138|Caenorhabditis elegans S. cerevisiae f... 42 3e-04 U39853-3|AAT92078.1| 151|Caenorhabditis elegans S. cerevisiae f... 42 3e-04 U39999-11|AAA81109.1| 143|Caenorhabditis elegans S. cerevisiae ... 35 0.038 >U39853-4|AAK39224.1| 138|Caenorhabditis elegans S. cerevisiae fis1-related protein2, isoform a protein. Length = 138 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = +2 Query: 251 KGILLLKELFNSHPE--GKRDYLFYLAIGNARIKEYNKALHYVKSFLEGGPGTQFA 412 +GI+ L++L + KR+Y++YLA+ +ARIK+Y+ AL Y+ L+ Q A Sbjct: 42 EGIVCLEKLLRDDEDRTSKRNYVYYLAVAHARIKQYDLALGYIDVLLDAEGDNQQA 97 >U39853-3|AAT92078.1| 151|Caenorhabditis elegans S. cerevisiae fis1-related protein2, isoform b protein. Length = 151 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = +2 Query: 251 KGILLLKELFNSHPE--GKRDYLFYLAIGNARIKEYNKALHYVKSFLEGGPGTQFA 412 +GI+ L++L + KR+Y++YLA+ +ARIK+Y+ AL Y+ L+ Q A Sbjct: 55 EGIVCLEKLLRDDEDRTSKRNYVYYLAVAHARIKQYDLALGYIDVLLDAEGDNQQA 110 >U39999-11|AAA81109.1| 143|Caenorhabditis elegans S. cerevisiae fis1-related protein1 protein. Length = 143 Score = 35.1 bits (77), Expect = 0.038 Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +2 Query: 251 KGILLLKELFN--SHPEGKRDYLFYLAIGNARIKEYNKALHYVKSFLEGGPGTQFA 412 +GI +L+++ + +H E R + YLA+ +AR+K Y+K+++ + + L P A Sbjct: 47 EGIEILEDVVSDTAHSEDSRVCVHYLALAHARLKNYDKSINLLNALLRTEPSNMQA 102 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,625,153 Number of Sequences: 27780 Number of extensions: 314792 Number of successful extensions: 793 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -