BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0370 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 2e-41 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_56| Best HMM Match : Actin (HMM E-Value=0) 165 3e-41 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 165 3e-41 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 143 9e-35 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 55 4e-08 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 54 7e-08 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54| Best HMM Match : Actin (HMM E-Value=0) 42 5e-04 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_1452| Best HMM Match : Oxidored_q4 (HMM E-Value=8.8) 27 9.3 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.3 SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 165 bits (402), Expect = 2e-41 Identities = 76/83 (91%), Positives = 81/83 (97%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 267 LYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 326 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGP+IVHRKCF Sbjct: 327 QQMWISKQEYDESGPAIVHRKCF 349 Score = 67.7 bits (158), Expect = 7e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 237 QPSFLGMESSGIHETTYNSIMKCDVDIRKDLYA 269 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 256 LYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 315 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGP+IVHRKCF Sbjct: 316 QQMWISKQEYDESGPAIVHRKCF 338 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 226 QPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 258 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 264 QPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 263 QPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 165 bits (400), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 264 QPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 163 bits (396), Expect = 1e-40 Identities = 76/83 (91%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +PSFLGM++ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 263 QPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 143 bits (347), Expect = 9e-35 Identities = 65/83 (78%), Positives = 74/83 (89%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L + VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTF Sbjct: 67 LYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTF 126 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWI+K+EY E GP IVHRKCF Sbjct: 127 QQMWIAKEEYHEYGPPIVHRKCF 149 Score = 59.3 bits (137), Expect = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLYA 510 +P+FLGM+A GIHE YN IMKCDVDIRKDLY+ Sbjct: 37 QPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYS 69 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 55.2 bits (127), Expect = 4e-08 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 16/103 (15%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERK 388 L ++ VLSGG+TM+ R+Q++I + P ++ ++I+ ++ Sbjct: 242 LYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQR 301 Query: 387 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*THR 259 Y+VW GGS+LAS F + +K +YDE GPSI F HR Sbjct: 302 YAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF-LHR 343 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 54.4 bits (125), Expect = 7e-08 Identities = 23/61 (37%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = -1 Query: 522 GLVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILAS 352 GL +++GG T+ G +R+ +E+ + P +M++K+I+ E++++ WIGGSILAS Sbjct: 170 GLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILAS 229 Query: 351 L 349 L Sbjct: 230 L 230 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 44.0 bits (99), Expect = 1e-04 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 29/101 (28%) Frame = -1 Query: 513 RHTVLSGGTTMYPGIA------------DRMQKEITALAPSTM----------------K 418 +H VLSGG+TMYPG+ +R+ K T+ S M K Sbjct: 299 KHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFK 358 Query: 417 IKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 298 I+I PP RK+ V++GG++LA + W++++EY+E G Sbjct: 359 IRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -2 Query: 608 KPSFLGMKACGIHETTYNSIMKCDVDIRKDLY 513 +PS LG GIHE+ + SI KCD+D+R +L+ Sbjct: 2308 QPSLLGRDIDGIHESIFKSIKKCDIDLRAELF 2339 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 9/81 (11%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIAPP-ERKYSVWIGG 367 L + VL GGT M PG R+ +EI L S +K+ PP + W+GG Sbjct: 77 LAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGG 136 Query: 366 SILASLSTFQQMWISKQEYDE 304 +I SL +++ Y + Sbjct: 137 AIFGSLEVLADRSTTRERYQQ 157 >SB_1452| Best HMM Match : Oxidored_q4 (HMM E-Value=8.8) Length = 154 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 481 HGGTTGQYGVAYKSLRMSTSHFMMELYVVSWM 576 H GT QY Y+ +RM MM + +V M Sbjct: 50 HSGTGPQYATPYQQVRMMAMRMMMMVILVVMM 81 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 362 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD 499 +DPP+ +Y L+GG ++ + FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPE 801 >SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 27.5 bits (58), Expect = 9.3 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 452 FCIRSAIPGYMVVPPDNTVWRTSP 523 FC PG + +P D T W+ P Sbjct: 32 FCCTVERPGLLTIPDDYTCWKVGP 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,328,284 Number of Sequences: 59808 Number of extensions: 451937 Number of successful extensions: 1380 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -