BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0369 (613 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 1.0 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.2 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 9.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.5 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 275 RQHNISSICNLRSIYIFQNVTSML 346 R HNIS++C I + Q V+ L Sbjct: 127 RDHNISALCKELGISVVQKVSHTL 150 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 72 VTISIGFIITVSFT 113 +++ IG +ITVSFT Sbjct: 417 ISLGIGEVITVSFT 430 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/50 (22%), Positives = 23/50 (46%) Frame = -2 Query: 609 WVLKALIAPQKEIPNLEKKKETFLQTINKLQQAILQKIIPQKCRLKCKRS 460 W++ LI+ P+ ++ + L NKL + ++ ++K K S Sbjct: 10 WIVLVLISGCSGNPDAKRLYDDLLSNYNKLVRPVVNVTDALTVKIKLKLS 59 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.0 bits (42), Expect = 9.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -1 Query: 136 LQEVFLLIVKETVIMKPILIVTLNNQLSLIFYLINYAFC 20 L +FL + ++ PI+ TLN F I Y C Sbjct: 408 LSSLFLWLGYCNSLLNPIIYATLNRDFRKPFREILYFRC 446 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 549 ETFLQTINKLQQAILQKIIPQKCRL 475 ++ LQT N QQ+ Q ++P K L Sbjct: 997 KSILQTANIKQQSPQQHVLPGKTLL 1021 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,412 Number of Sequences: 438 Number of extensions: 3475 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -