BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0368 (511 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096) 29 1.7 SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 >SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096) Length = 1276 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = -3 Query: 503 GTYINKTGCC--RLIISFSHLANLPGLIFITRVEVLIL*HSGYFPNERNMTNKINIVT 336 G Y+++ C +L +S+ H ++P + + +E+L L +G P+ + + + +NIVT Sbjct: 877 GAYVSEMNECFRKLFLSY-HGQSMPDHLLVATLEILSLTSTGINPDVKLLHHVMNIVT 933 >SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 75 YQVNSSIPPLKWGNLYVFIRAIKSDVRLCASCNAIYVSATSRKKIG 212 +++ + + P++ N Y+F RAI CA+ + Y R+ G Sbjct: 762 FEIETDLLPIEHNNFYLFSRAIPPIFMACAASSPKYGDQFGRRISG 807 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,044,291 Number of Sequences: 59808 Number of extensions: 263698 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -