BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0368 (511 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032661-1|CAA21755.1| 182|Caenorhabditis elegans Hypothetical ... 29 2.6 U61944-5|AAB03121.2| 482|Caenorhabditis elegans Hypothetical pr... 28 4.5 Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical pr... 27 7.9 AL117204-1|CAB55141.1| 328|Caenorhabditis elegans Hypothetical ... 27 7.9 >AL032661-1|CAA21755.1| 182|Caenorhabditis elegans Hypothetical protein Y73F4A.1 protein. Length = 182 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -3 Query: 443 NLPGLIFITRVEVLIL*HSGYFPNERN-MTNKINIVTFSCMYISNQKTMATLKQSTNLPS 267 NL +IF R + +I +SGY P ++ + + ++ VT + + I+ K T+ + P+ Sbjct: 66 NLESIIFSRREDNVITTNSGYTPKKKKVVVDDVSYVTVNDVQITGNKLKVTVSRPLG-PA 124 Query: 266 G 264 G Sbjct: 125 G 125 >U61944-5|AAB03121.2| 482|Caenorhabditis elegans Hypothetical protein T12E12.1 protein. Length = 482 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +3 Query: 129 IRAIKSDVRLCASCNAIYVSATSRKKIGEFFAKCTLSF*SQDYFNA*WKICRLFQCC 299 + ++ C C A Y + TS + I ++ KC + +Y +A K C C Sbjct: 237 VTCMQCHTSFCVKCGADYHAPTSCETIKQWMTKCADDSETANYISAHTKDCPQCHSC 293 >Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical protein F43A11.6 protein. Length = 322 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = +1 Query: 196 LEKKSASFSQNAP*VFEVKIISMPDGRFVDCFSVAMVF*LLIYIQENVTILILFVIFRSL 375 + S +++ P II + +G F ++++V+ + +Y+ + T L +FRSL Sbjct: 5 MSSSSVTYNYKDPLNLLASIIMIVNGIFGSVCNLSIVY-IFMYVPKEKTSFNLICVFRSL 63 Query: 376 G 378 G Sbjct: 64 G 64 >AL117204-1|CAB55141.1| 328|Caenorhabditis elegans Hypothetical protein Y116A8C.1 protein. Length = 328 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 84 NSSIPPLKWGNLYVFIRAIKS 146 NS++PP ++ N+Y +I I+S Sbjct: 238 NSALPPTRYSNMYFWIDGIRS 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,906,237 Number of Sequences: 27780 Number of extensions: 222855 Number of successful extensions: 431 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -