BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0364 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.1 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 1.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.5 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 3.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +1 Query: 187 HFLRESTLFISW*NAFH---SRRSKAYLYLCQA 276 +F+ +ST+F+SW NA H R Y +C A Sbjct: 327 NFVDQSTVFLSW-NAPHMLGGRTDTTYRVVCDA 358 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 521 WTHQQYPVDL*H*ARA*RSSPVHSGYIQARQHLLSV 628 WT+ Y VDL H A+ S+ + G I + +SV Sbjct: 166 WTYDGYTVDLRHLAQTEDSNQIEVG-IDLTDYYISV 200 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 2.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 185 GRKLPRYCDVNHD 147 G+K+PRYC H+ Sbjct: 598 GKKMPRYCLFGHN 610 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 285 VHVAACSSLEAPHFTMSPGAVPFP 356 + V C + HF PG VP P Sbjct: 24 IGVDECQATPVIHFLQYPGCVPKP 47 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,500 Number of Sequences: 438 Number of extensions: 4169 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -