BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0363 (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr... 26 4.0 SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizo... 25 7.0 >SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 537 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 331 PSIVGSSYVLISLHQFVLMYEKLHLSIICFTALKKT 438 PS+ GS+ +L F + +HL II F + T Sbjct: 450 PSVAGSAIAAFTLPSFAIAAVLVHLGIIMFDNMTTT 485 >SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1513 Score = 25.4 bits (53), Expect = 7.0 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 618 GASRGSTAPIRGPGLPNTSYFHLTLYRKEPFGLSIIPSE 502 G S+ T+ I+ LP+ F L Y EP+ L +P E Sbjct: 385 GLSQAYTSTIQS-SLPSKEVFPLEKYSSEPWNLHNLPFE 422 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,818,043 Number of Sequences: 5004 Number of extensions: 60002 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -