BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0363 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.0 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 3.6 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 8.2 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 8.2 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 8.2 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 8.2 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 8.2 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 8.2 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 8.2 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 23 8.2 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 568 YQLLPFDSIQKRAVWIVDNPIRDRFII 488 Y L PF+ I++ A++I+ +P+ FII Sbjct: 133 YVLDPFNPIRRVAIYILVHPLFSLFII 159 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 570 LGALAHGWEQYSPSRPRTWALYSN 641 LG L HGWEQ + R + + N Sbjct: 373 LGPLPHGWEQRKTASGRVYFVDHN 396 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 595 SHPWARAPKYQLLPFDSIQKRAVWIVD 515 +H LLP D + KRA W+++ Sbjct: 177 THSCVSPEPVNLLPDDELVKRAQWLLE 203 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 595 SHPWARAPKYQLLPFDSIQKRAVWIVD 515 +H LLP D + KRA W+++ Sbjct: 177 THSCVSPEPVNLLPDDELVKRAQWLLE 203 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 595 SHPWARAPKYQLLPFDSIQKRAVWIVD 515 +H LLP D + KRA W+++ Sbjct: 153 THSCVSPEPVNLLPDDELVKRAQWLLE 179 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 595 SHPWARAPKYQLLPFDSIQKRAVWIVD 515 +H LLP D + KRA W+++ Sbjct: 153 THSCVSPEPVNLLPDDELVKRAQWLLE 179 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 530 RLDCR*SHQRSFYNK*PVIKDCNSYFWRMKAVFLRAVKHIILRWSFS 390 +L+C H + PV++ + FW M + A+ II+ W S Sbjct: 76 KLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM-WVMS 121 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 530 RLDCR*SHQRSFYNK*PVIKDCNSYFWRMKAVFLRAVKHIILRWSFS 390 +L+C H + PV++ + FW M + A+ II+ W S Sbjct: 76 KLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM-WVMS 121 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 530 RLDCR*SHQRSFYNK*PVIKDCNSYFWRMKAVFLRAVKHIILRWSFS 390 +L+C H + PV++ + FW M + A+ II+ W S Sbjct: 76 KLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFVAIFTIIM-WVMS 121 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 642 DSSIKPKCGASRGSTAPIRGPGLPNT 565 D++I KC A + PG+P T Sbjct: 45 DNAIMEKCRAENPKPGQMPAPGVPRT 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,469 Number of Sequences: 2352 Number of extensions: 14318 Number of successful extensions: 30 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -