Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0363
         (643 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U29097-1|AAA68411.1| 1490|Caenorhabditis elegans Hypothetical pr...    29   2.1  

>U29097-1|AAA68411.1| 1490|Caenorhabditis elegans Hypothetical
           protein F18C5.3 protein.
          Length = 1490

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 539 EKSRLDCR*SHQRSFYNK*PVIKDCNSYFWRMKAVFLR 426
           +KS  D   +  +S     P++KD  SYFWR+  +F R
Sbjct: 228 KKSNEDTLVNMMKSLARIAPLLKDPQSYFWRLPKLFSR 265


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,373,380
Number of Sequences: 27780
Number of extensions: 327042
Number of successful extensions: 666
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 666
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1427403330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)