BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0362 (495 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 34 0.074 SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_59039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) 31 0.39 SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 30 0.91 SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) 30 0.91 SB_33679| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 29 2.8 SB_57923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_44770| Best HMM Match : 7tm_3 (HMM E-Value=3e-06) 28 3.7 SB_55399| Best HMM Match : C1_4 (HMM E-Value=4.8) 28 3.7 SB_13837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_30892| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 33.9 bits (74), Expect = 0.074 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGVSVEMTADR-EWKRKTSCA 111 GRP+K W E + +D++ G++ T DR WK K + A Sbjct: 588 GRPRKNWHEVLREDLKLAGLTPHDTQDRVRWKLKLNHA 625 >SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 32.3 bits (70), Expect = 0.23 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 352 YYFSLLYTYIQFFKHKFFRGYYYLFIFYC 438 YY+ Y Y ++ + ++ YYY + +YC Sbjct: 5 YYYHYYYYYYYYYYYYYYYYYYYYYYYYC 33 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 337 MMYAPYYFSLLYTYIQFFKHKFFRGYYYLFIFYC 438 M Y YY Y Y ++ + ++ YYY + + C Sbjct: 1 MSYYYYYHYYYYYYYYYYYYYYYYYYYYYYYYCC 34 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.9 bits (69), Expect = 0.30 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ H ++ YYY + +Y Sbjct: 114 YYYYYYYYYYYYYYYYYHHYYYYYYYYYYYY 144 Score = 31.9 bits (69), Expect = 0.30 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ H ++ YYY + +Y Sbjct: 115 YYYYYYYYYYYYYYYYHHYYYYYYYYYYYYY 145 Score = 30.3 bits (65), Expect = 0.91 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 110 YYYYYYYYYYYYYYYYYYYYYHHYYYYYYYY 140 Score = 29.5 bits (63), Expect = 1.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 130 YHHYYYYYYYYYYYYYYYYYYYYYYYYYYYY 160 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 133 YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 163 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 134 YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 164 Score = 28.7 bits (61), Expect = 2.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 119 YYYYYYYYYYYYHHYYYYYYYYYYYYYYYYY 149 Score = 28.7 bits (61), Expect = 2.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 125 YYYYYYHHYYYYYYYYYYYYYYYYYYYYYYY 155 Score = 28.3 bits (60), Expect = 3.7 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 352 YYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 YY+ Y Y ++ + ++ YYY + +Y Sbjct: 103 YYYYYYYYYYYYYYYYYYYYYYYYYYYY 130 Score = 28.3 bits (60), Expect = 3.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + + YYY + +Y Sbjct: 111 YYYYYYYYYYYYYYYYYYYYHHYYYYYYYYY 141 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y + + ++ YYY + +Y Sbjct: 116 YYYYYYYYYYYYYYYHHYYYYYYYYYYYYYY 146 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y + + ++ YYY + +Y Sbjct: 118 YYYYYYYYYYYYYHHYYYYYYYYYYYYYYYY 148 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY Y Y ++ + ++ YYY + +Y Sbjct: 126 YYYYYHHYYYYYYYYYYYYYYYYYYYYYYYY 156 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 +A YY+ Y Y ++ + ++ YYY + ++ Sbjct: 101 HAYYYYYYYYYYYYYYYYYYYYYYYYYYYYH 131 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ +YY + +Y Sbjct: 109 YYYYYYYYYYYYYYYYYYYYYYHHYYYYYYY 139 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 124 YYYYYYYHHYYYYYYYYYYYYYYYYYYYYYY 154 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y +Y+ Y Y ++ + ++ YYY + +Y Sbjct: 129 YYHHYYYYYYYYYYYYYYYYYYYYYYYYYYY 159 Score = 27.1 bits (57), Expect = 8.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y + ++ + ++ YYY + +Y Sbjct: 121 YYYYYYYYYYHHYYYYYYYYYYYYYYYYYYY 151 Score = 27.1 bits (57), Expect = 8.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ + Y ++ + ++ YYY + +Y Sbjct: 122 YYYYYYYYYHHYYYYYYYYYYYYYYYYYYYY 152 Score = 27.1 bits (57), Expect = 8.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + ++ Sbjct: 135 YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYH 165 >SB_59039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 31.5 bits (68), Expect = 0.39 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 YA YY+ Y Y ++ + ++ YYY + +Y Sbjct: 16 YAYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 46 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 18 YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 48 >SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) Length = 296 Score = 31.5 bits (68), Expect = 0.39 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ H ++ YYY + +Y Sbjct: 262 YYYYYYYYYYYYYYYYYHYYYYYYYYYYYYY 292 Score = 31.1 bits (67), Expect = 0.52 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFYC 438 Y YY+ Y Y + + ++ YYY + +YC Sbjct: 264 YYYYYYYYYYYYYYYHYYYYYYYYYYYYYYYC 295 Score = 30.3 bits (65), Expect = 0.91 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFYCLR 444 Y YY+ Y Y ++ + ++ YYY + +Y R Sbjct: 263 YYYYYYYYYYYYYYYYHYYYYYYYYYYYYYYYCR 296 Score = 29.5 bits (63), Expect = 1.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 343 YAPYYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 Y YY+ Y Y ++ + ++ YYY + +Y Sbjct: 261 YYYYYYYYYYYYYYYYYYHYYYYYYYYYYYY 291 Score = 28.7 bits (61), Expect = 2.8 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 352 YYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 YY+ Y Y ++ + ++ YYY + +Y Sbjct: 260 YYYYYYYYYYYYYYYYYYYHYYYYYYYY 287 >SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 666 Score = 30.3 bits (65), Expect = 0.91 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGV----SVEMTADR-EWKRKTSCADPT 120 GRPK TW + ++ E G+ ++++ DR EW+ + + PT Sbjct: 616 GRPKTTWRRTIQAELLEMGLTWGKALKVAKDRQEWRHRVAALFPT 660 >SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) Length = 280 Score = 30.3 bits (65), Expect = 0.91 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGV----SVEMTADR-EWKRKTSCADPT 120 GRPK TW + ++ E G+ ++++ DR EW+ + + PT Sbjct: 230 GRPKTTWRRTIQAELLEMGLTWGEALKVAKDRQEWRHRVAALFPT 274 >SB_33679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 1.6 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGVSVEMTADRE 87 GRP+KTW + D++ G+ + ++R+ Sbjct: 81 GRPRKTWADATLSDLKTAGLKASVASNRK 109 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 353 IIFLCCILTYNFLNINFLGVIIIYLFFIAYV 445 ++F + Y FL + F V+ I++FF A+V Sbjct: 683 VVFAFVVYPYFFLFVVFAFVVFIFIFFFAFV 713 >SB_57923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 151 SSSFSPPYLTKWGRHS*FFSSILYQPSSQH 62 ++ F+PP L++ + F S I Y+PSSQH Sbjct: 139 NNCFTPPVLSRRYDTAFFISFIGYEPSSQH 168 >SB_44770| Best HMM Match : 7tm_3 (HMM E-Value=3e-06) Length = 155 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 341 CTHRIIFLCCILTYNFLNINFLGVIIIYLFFIAYVDR 451 CTH++I+L C+ TY G+++I+ F+A+ R Sbjct: 61 CTHKLIWLGCLYTYK-------GLLMIFGLFLAWETR 90 >SB_55399| Best HMM Match : C1_4 (HMM E-Value=4.8) Length = 335 Score = 28.3 bits (60), Expect = 3.7 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 352 YYFSLLYTYIQFFKHKFFRGYYYLFIFY 435 YY+ Y Y ++ + ++ YYY + +Y Sbjct: 266 YYYYYYYYYYYYYYYYYYYYYYYYYYYY 293 >SB_13837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.3 bits (60), Expect = 3.7 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGVSV----EMTAD-REWKRKTSCADPT 120 GRPK TW + ++ E +++ M D R+WKR + PT Sbjct: 22 GRPKTTWRRTILSELSEHQLTLAEAQHMARDRRKWKRFVAALCPT 66 >SB_30892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 1 GRPKKTWMECVNDDMRERGVSVEMTADREWK-RKT 102 GR + W++ ++ R +E DREWK RKT Sbjct: 148 GRSDREWLDSQTENGRTERQKMEGQKDREWKDRKT 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,319,775 Number of Sequences: 59808 Number of extensions: 266692 Number of successful extensions: 716 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -