BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0358 (514 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 2.1 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 4.9 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 6.4 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 151 ILFHVFSREKLYRPCPNMIFKEIHTKSH*RFAKM 50 +L HV+ KL+ CP I ++I + F K+ Sbjct: 9 VLKHVWFLSKLFLLCPRSIDEKIKRQERHSFYKI 42 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.4 bits (43), Expect = 4.9 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 303 PPXXXXXXXXTSPQRRPALAAPCQGPLT 386 PP SP RR A + PC T Sbjct: 171 PPDWEGTTLSQSPNRRRASSNPCHNGAT 198 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.0 bits (42), Expect = 6.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 342 QRRPALAAPCQGPLTPPHHIHL 407 Q+ + P QGPLTP + H+ Sbjct: 176 QKTKSSNRPHQGPLTPILYDHI 197 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,922 Number of Sequences: 336 Number of extensions: 2582 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -