BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0358 (514 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 22 4.3 AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor pro... 22 4.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.7 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.9 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 9.9 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 9.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.9 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.9 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 339 PQRRPALAAPCQGPLTP 389 P RRP P QGP P Sbjct: 29 PGRRPFPTFPGQGPFNP 45 >AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor protein. Length = 33 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 339 PQRRPALAAPCQGPLTP 389 P RRP P QGP P Sbjct: 15 PGRRPFPTFPGQGPFNP 31 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 446 PGLGGPLALVHKCQVNVVRWRQRALARRSQ 357 P + +ALV + +RWR R L R Q Sbjct: 1616 PLIVATVALVVAVVIVALRWRSRYLGDRMQ 1645 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 446 PGLGGPLALVHKCQVNVVRWRQRALARRSQ 357 P + +ALV + +RWR R L R Q Sbjct: 1612 PLIVATVALVVAVVIVALRWRSRYLGDRMQ 1641 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 458 VSSEPGLGGPLALV 417 V++ G+GGP++LV Sbjct: 180 VNASTGMGGPVSLV 193 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 410 TCGLALVGPQDQAPTT 457 TC LA+ Q+Q P T Sbjct: 518 TCSLAVAKQQNQVPLT 533 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 226 TQWVAYFGSTGESGACGSAGRNGRT 300 TQ FGS+ E A G+ GRT Sbjct: 102 TQAEGIFGSSEECVALDLDGQGGRT 126 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 432 PTSASPQVSGECGEVASAGPGTA 364 PT +SPQ SG + A T+ Sbjct: 64 PTGSSPQHSGSSASTSPAARTTS 86 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 133 KTRETKSLIVGQFFLC 180 K +T +IVG F LC Sbjct: 6 KAAKTLGIIVGGFILC 21 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 133 KTRETKSLIVGQFFLC 180 K +T +IVG F LC Sbjct: 454 KAAKTLGIIVGGFILC 469 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 226 TQWVAYFGSTGESGACGSAGRNGRT 300 TQ FGS+ E A G+ GRT Sbjct: 70 TQAEGIFGSSEECVALDLDGQGGRT 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,994 Number of Sequences: 438 Number of extensions: 3118 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -