BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0355 (671 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21... 26 4.3 SPCC4B3.05c |hem12||uroporphyrinogen decarboxylase |Schizosaccha... 26 4.3 SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces p... 26 5.7 SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces po... 25 7.5 SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr... 25 7.5 SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|... 25 7.5 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 25 7.5 SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 25 9.9 >SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 26.2 bits (55), Expect = 4.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 239 QPLVPSHR*QVTPQNPGIN*SPRSLALKSTGSMAVDMPRWLAEV 108 Q PS R +V PQ PG++ +P SL + ++ +EV Sbjct: 109 QMSTPSRRREVDPQRPGVS-TPSSLLFSGSDALTFSQAHPSSEV 151 >SPCC4B3.05c |hem12||uroporphyrinogen decarboxylase |Schizosaccharomyces pombe|chr 3|||Manual Length = 355 Score = 26.2 bits (55), Expect = 4.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 275 SWPGSELSPMSITTYGYPF 331 SW G ELSP T Y YP+ Sbjct: 208 SWAG-ELSPEDFTEYAYPY 225 >SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces pombe|chr 1|||Manual Length = 612 Score = 25.8 bits (54), Expect = 5.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 184 IDLLAVWPSRVQVRWPWICHDG 119 +DLL PS Q W WI H G Sbjct: 283 LDLLLHPPSSAQKNWSWIKHVG 304 >SPAC9G1.09 |sid1||PAK-related kinase Sid1|Schizosaccharomyces pombe|chr 1|||Manual Length = 471 Score = 25.4 bits (53), Expect = 7.5 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -3 Query: 303 IGDSSEPGQDP---ARVSIARW-LPTTAGTKSSLTGNSTEPRDKLISSQS 166 I ++ +P ++P I W T + S++ GN++ P++ +ISSQ+ Sbjct: 293 INNTLKPFEEPIAEGNADIEDWTFETVKKSDSTVLGNTSIPKNSIISSQN 342 >SPBC29A10.07 |||nucleoporin Pom152|Schizosaccharomyces pombe|chr 2|||Manual Length = 1250 Score = 25.4 bits (53), Expect = 7.5 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -3 Query: 408 THNTSTQFLIFHTTVF*DDYMVIGIQNGYPYVVMDIGDSSEPG--QDPARVSIARWLP 241 +H + + H V D + ++ Y ++ + DSS PG Q+ + WLP Sbjct: 780 SHTSGLNKVSHHKEVLNDPNSYLTVRKSGTYTLLSVSDSSCPGTIQNVEQKYQVEWLP 837 >SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.4 bits (53), Expect = 7.5 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 10/71 (14%) Frame = -2 Query: 475 HTNSHSLRNTRTS*KHT-----LTHVTHSQHFNTISNISH---YRFLGRLHGDRHSERIP 320 +TNS+++ ++R S KHT H + N+++++ H F+ G + +E IP Sbjct: 228 YTNSNTVTSSRISLKHTDPTKWQKHAKRTASSNSLTDLLHASNQTFMAPASGLQSTEEIP 287 Query: 319 VCS-DGH-RGQ 293 S GH RG+ Sbjct: 288 QFSKTGHSRGR 298 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 25.4 bits (53), Expect = 7.5 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +1 Query: 304 VHHYIRVSV--LNADHHVVVLKN 366 VHH +R+S+ LN D HV L+N Sbjct: 292 VHHKLRLSISLLNPDGHVSELRN 314 >SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 689 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 572 YQHTNDLYHITAYN-KLYNALMIHALKYNRHY 480 Y+HTND + ITA L N++++ NR + Sbjct: 29 YKHTNDFFKITATTYALINSVIVSNNCCNRRF 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,049,334 Number of Sequences: 5004 Number of extensions: 69567 Number of successful extensions: 174 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -