BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0354 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 3.8 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.9 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 86 YRTIDRAGEEGKQQRLHAADLATVHQSS 3 + T+D + E+GK+ L +L T Q S Sbjct: 1027 FETVDFSKEDGKEHHLQIMNLKTYTQYS 1054 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 357 SAASDKNALCAHWLTEADDALNSEWISHGAIWNNHRTA 244 S ASD L W+ + + W+S +NHR A Sbjct: 324 STASDFKQLIDRWVANVPNGSVTNWVSGN--HDNHRVA 359 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 303 DALNSEWISHGAIWNNHRTAISGRGWKK 220 D L+SEW S +N + GW+K Sbjct: 194 DDLSSEWDSDYTDKSNEKKIPKSSGWRK 221 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 282 STQNLARRQPQLASERTEHFCR*LPNPARIQTQ 380 S + +PQ++ +RT L NPA IQ+Q Sbjct: 405 SQSTIQTLRPQVSPDRTSPMEYRLYNPALIQSQ 437 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 397 KPKRRLPAVL 426 KPKRRLP +L Sbjct: 402 KPKRRLPHIL 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,247 Number of Sequences: 438 Number of extensions: 4878 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -