Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0352
         (537 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01587-1|AAA27734.1|   69|Apis mellifera zinc finger protein pro...    23   2.0  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   3.5  
DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 vari...    21   6.0  
DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 vari...    21   6.0  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    21   6.0  

>L01587-1|AAA27734.1|   69|Apis mellifera zinc finger protein
           protein.
          Length = 69

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = -3

Query: 130 RSAHGSENLLCERYCQNVVLKFTDTSHKRVHSSL*YEVR 14
           R+  GS+   CE+   + V K    SH + HS++ Y+ R
Sbjct: 9   RNHFGSKPFKCEKCSYSCVNKSMLNSHLKSHSNV-YQYR 46


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 4/27 (14%)
 Frame = +2

Query: 350 HQYEH----KEISSLRLSMDSWTSRQP 418
           H Y+H      + S+R ++  WT RQP
Sbjct: 466 HPYDHLVWNSWMPSIRGAIQQWTCRQP 492


>DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 variant
           2 precursor protein.
          Length = 94

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 100 CERYCQNVVLK 68
           C+R+C NVV K
Sbjct: 50  CQRFCPNVVPK 60


>DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 variant
           1 precursor protein.
          Length = 92

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 100 CERYCQNVVLK 68
           C+R+C NVV K
Sbjct: 50  CQRFCPNVVPK 60


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 393 WILGLHDNH 419
           W+ G HDNH
Sbjct: 348 WVSGNHDNH 356


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,996
Number of Sequences: 438
Number of extensions: 3132
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15213684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)