BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0346 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 30 1.2 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 30 1.2 09_02_0036 + 3217163-3217584,3217752-3218322 30 1.2 06_01_0092 - 775290-775691 28 6.7 05_06_0148 + 25989595-25990956 28 6.7 11_02_0098 + 8292536-8292787,8292909-8292920 27 8.8 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 27 8.8 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 360 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 503 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 446 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 360 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 503 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 451 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 298 ITIHWPSFYNVV-TGKTLALPNLIALQH 378 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >06_01_0092 - 775290-775691 Length = 133 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 418 RASSLLRQLAKGGCAARR 365 RA+SLLRQL + GCAA + Sbjct: 22 RAASLLRQLIEDGCAAAK 39 >05_06_0148 + 25989595-25990956 Length = 453 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -2 Query: 157 VILNLNEPPTLNVDSQEVLSPVITQIIILRVSFLLHDVIPSDPPPPN 17 VI+ + PP D +P + +I S H++ P D P P+ Sbjct: 15 VIIAVPTPPASTADVAASSAPAVARIAAANPSISFHNLPPPDYPEPD 61 >11_02_0098 + 8292536-8292787,8292909-8292920 Length = 87 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = -2 Query: 127 LNVDSQEVLSPVITQIIILRVSFLLHDVIPSDPPPPNRRQ 8 + +D Q V + ++ +ILR+S L V PS PPPP RQ Sbjct: 48 IGLDKQRV--KLYSERMILRLSDLCAPV-PSRPPPPPHRQ 84 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 310 WPSFYNVV-TGKTLALPNLIALQH 378 W F N+V +G TL+LP + LQH Sbjct: 133 WSRFTNLVQSGPTLSLPEYVLLQH 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,316,669 Number of Sequences: 37544 Number of extensions: 401754 Number of successful extensions: 1201 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -