BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0346 (608 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-8|AAF99897.3| 950|Caenorhabditis elegans Importin beta f... 31 0.64 Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 29 3.4 >U42436-8|AAF99897.3| 950|Caenorhabditis elegans Importin beta family protein 6 protein. Length = 950 Score = 31.1 bits (67), Expect = 0.64 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -2 Query: 172 LLEPIVILNLNEPPTLNVDSQEVLSPVITQIIILRVSFLLHDVIPSD 32 L P I+N EP T V S PV +L V F LH++IPS+ Sbjct: 415 LKRPEAIINAVEPWTAEVTSGGSSIPVNRIEALLNVIFHLHEIIPSN 461 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 467 LPFAIQAAQLLGRAIGAGLFAITPAGE--RGMCCKAIKLGNARV 342 L F+ + L G++IGA L T AGE G K +K G++RV Sbjct: 761 LDFSSDSQYLRGQSIGAHLLFWTKAGEICDGTSVKDVKWGSSRV 804 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,373,363 Number of Sequences: 27780 Number of extensions: 297088 Number of successful extensions: 642 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -