BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0341 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 2.5 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 23 2.5 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 158 FNV*LSQVKRRLFMRGCRPDGNNPAIS 78 FN + +R+ +G R GN P+ S Sbjct: 328 FNTEFREAFKRILTKGARARGNQPSTS 354 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +1 Query: 226 LIYPHQYPVSSHFITRVLGVAEKRK*HLEMAFML 327 ++ PH+ P S+++ G + H E+ +ML Sbjct: 3 ILIPHRNPASANYYENKDGARIVKASHFELDYML 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,486 Number of Sequences: 438 Number of extensions: 2755 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -