BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0338 (541 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 0.98 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 1.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 5.2 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.9 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.8 bits (49), Expect = 0.98 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 40 SSNAFRFEGWGCR*NYTETLELISPGGWRI 129 + N+ ++ G Y E +EL GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.0 bits (47), Expect = 1.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 535 PVRWVPTRWDS 503 P+RWV WDS Sbjct: 264 PIRWVAKLWDS 274 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 5.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 452 FYESITNLLQLN*ILKRLSVECKMYFFIRQYTTIPGKV 339 FY+S+TN + + +K SVE ++ F R +P +V Sbjct: 301 FYKSLTNDWEDHLAVKHFSVEGQLEF--RALLFVPRRV 336 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 5.2 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = -2 Query: 534 QCGGYQPGGTHKTSYPPVNMRGKYYCSLL*INYEPF 427 QCG Y P G V G LL YE + Sbjct: 635 QCGDYVPSGNSTVDCDDVGTFGAILKKLLPKVYEDY 670 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 378 IHFTLDTESLKDLI*LQKVRN*FIEVNNNIFLAYLLG 488 I++TL LK + Q+V+N V + FL+ + G Sbjct: 351 INYTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFG 387 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,471 Number of Sequences: 336 Number of extensions: 3189 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -