BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0338 (541 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3393| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=0.012) 29 3.2 SB_48677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 >SB_3393| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=0.012) Length = 626 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 239 VICLRNLAFCETEAVVEYKQLRIAVRSAVIYLTQL 343 ++CL + C T +V QL + + V+ LTQL Sbjct: 143 IVCLTQVILCPTRLIVCLTQLIVCLTQFVVCLTQL 177 >SB_48677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 586 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +2 Query: 239 VICLRNLAFCETEAVVEYKQLRIAVR-SAVIYLTQLYRVLL 358 V+CL ++A C + +VEY +L +A R +A + LT R+++ Sbjct: 88 VVCLADIAICTSLLLVEY-ELDLATRITASLALTLALRLVM 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,568,803 Number of Sequences: 59808 Number of extensions: 367299 Number of successful extensions: 729 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -