BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0336 (589 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.12c |||CorA family magnesium ion transporter |Schizosa... 25 8.2 >SPBC27B12.12c |||CorA family magnesium ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.0 bits (52), Expect = 8.2 Identities = 13/65 (20%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 145 WGLKSSDPEQLPVLVIGQSGHLNQLSWSDVRCKLEPRSLRRHGNEVYLVYQHHRVNP-VS 321 W L DP + + V+ ++ ++ L+ D+R + + G+ ++ ++ +P ++ Sbjct: 498 WWLDCLDPTDIEMRVLSKAFSIHPLTTEDIRVQEAREKVELFGSYYFVCFRSFEQDPELA 557 Query: 322 CGLEP 336 LEP Sbjct: 558 NYLEP 562 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,983,766 Number of Sequences: 5004 Number of extensions: 36195 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -