BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0333 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.6 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 7.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.6 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 150 FSFRKKKLSFSLILSITKRI*SSVDI*DKHNPLQTEFVPS 269 F+F KK L +S +S S+ D + EFV S Sbjct: 172 FTFHKKNLYYSFYISDKAARPRSLQFVDSEGNILEEFVLS 211 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 235 NIILYKQNLFLLYKLI 282 N++LY LF+L K++ Sbjct: 295 NVVLYGLELFILAKIV 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,031 Number of Sequences: 336 Number of extensions: 3204 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -