BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0333 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.2 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 3.8 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 3.8 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 3.8 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 495 VLFIIVKTLIAMLIIF*SFNKIISALSLYMLKL 593 VLF+I+ L+ +I I S +LY LKL Sbjct: 10 VLFVIINVLLHGQVICFVCKDITSTSALYRLKL 42 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 327 IQINAVHNILDLA*SYKFIKKEQILF 250 I V NILD S K + K +LF Sbjct: 293 IHYEGVQNILDTQSSAKVVSKSGVLF 318 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 327 IQINAVHNILDLA*SYKFIKKEQILF 250 I V NILD S K + K +LF Sbjct: 293 IHYEGVQNILDTQSSAKVVSKSGVLF 318 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 327 IQINAVHNILDLA*SYKFIKKEQILF 250 I V NILD S K + K +LF Sbjct: 293 IHYEGVQNILDTQSSAKVVSKSGVLF 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,641 Number of Sequences: 438 Number of extensions: 3171 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -