BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0332 (306 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 23 7.7 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 23.4 bits (48), Expect = 7.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -2 Query: 275 IVILYYVILRKLVRLSVM---NQSISTFNNYRYLFVL 174 +VI+ Y L +LV+L N ++ NNYR F L Sbjct: 124 LVIIVYNFLWRLVKLVFTKNTNDELAIKNNYRLCFSL 160 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,023,061 Number of Sequences: 5004 Number of extensions: 14451 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 77794588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -