BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0332 (306 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0374 - 2843405-2843508,2844134-2844239,2844327-2844409,284... 29 0.55 01_06_1685 + 39170428-39171735 25 8.9 >11_01_0374 - 2843405-2843508,2844134-2844239,2844327-2844409, 2844886-2845078,2845527-2845662,2846185-2846264, 2846348-2846932,2847058-2847126,2847203-2847347, 2847442-2847542,2848208-2849066,2849397-2849536, 2849606-2849783,2849885-2850287,2850770-2850833, 2851223-2851278,2851470-2851572 Length = 1134 Score = 29.5 bits (63), Expect = 0.55 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 257 VILRKLVRLSVMNQSISTFNNYRYLFVLSETV 162 ++L L L++MN I F + RYLF L+ TV Sbjct: 725 LVLSLLFMLTIMNVPIKYFPHSRYLFALAPTV 756 >01_06_1685 + 39170428-39171735 Length = 435 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 195 LPLSIRAIGDSANAHDGAAVRSGANHSDKR*P 100 LPL +GD A+ HD A S +DK+ P Sbjct: 357 LPLDFFKVGDLASVHDLATYISLLRGADKKQP 388 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,273,433 Number of Sequences: 37544 Number of extensions: 88879 Number of successful extensions: 151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 363831720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -